HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0236COG0589arCOG04802hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0236 nrc1 VNG2521 vng2521 no entry
cHOG0236 hmu HMUK0223 Hmuk_0223 UspA domain protein
cHOG0236 hma RRNAC2221 hypothetical protein
cHOG0236 hwa HQ1065A usp homolog to stress response protein
cHOG0236 hla HLAC1930 Hlac_1930 UspA domain protein
cHOG0236 hbo HBOR03850 Hbor_03850 universal stress family protein
cHOG0236 hut HUTA0966 Huta_0966 UspA domain protein
cHOG0236 hvo HVO_1822 HVO_1822 universal stress protein
cHOG0236 nph NP1718A homolog to stress response protein
cHOG0236 hhi 2693 HAH_2693 UspA domain-containing protein
MUSCLE (3.6) multiple sequence alignment


966|gene|hut       ----------------------------------------------MAVEIDTILVPVDG
12221|hp|hma       MTTVSNIHHASKPRLNTLLVTARDSPYDTTLPARTPVDFCRPGSQWRVMDIDLVLAPVDG
2693|gene|hhi      ------------------------------------------------MDIDLVLAPVDG
1718|gene|nph      ------------------------------------------------MDVDTVLVPVDG
2521|hp|nrc1       ----------------------------------------------MPLTVDTVLAPVDG
1065|gene|hwa      ------------------------------------------MTENRLLSVDLILAPIDA
1930|gene|hla      ---------------------------------------------MTDLDIDLVLVSVDG
3850|gene|hbo      ------------------------------------------MSDRRPLDVNLVLVPVDR
                                                                   : :: :*..:* 

966|gene|hut       TDRSDRAVKHALPIADRYDAEVHILYVIEETVAAGLEQGDIEADSVANEHRAFMDAVREQ
12221|hp|hma       SDQSERAAEYAIAVAERYDADLHLLFVIDERLHQDIDSGDVSATAIAEEHQAFTESIRDR
2693|gene|hhi      SDQSERAAEYAIAVAERYDADLHLLFVIDERLHQDIDSGDVSATAIAEEHRAFTESIRER
1718|gene|nph      SETAMDAVEYAVEIADRYGAGVHALYLVGENAAAEMEAGAVDATDIATRGEQIMASVRAI
2521|hp|nrc1       TDASVTAAEYAVTVADRYDADAHALYVLGETVTRAIGTGDVAEDDVAAGTNTFLNEIAAL
1065|gene|hwa      SEESLDAVEYASVIAAKYDASVHVVHVLDEDIVQAIETGTVDKSAVATDGQTITESAETI
1930|gene|hla      SEESHEAVDYAIAVAAEYDASVHALYVLDEDVVRAIDHGVVDEGDVADDTEAFTDSVVRR
3850|gene|hbo      SEESANAVEHAAAIAAEYDAAVHAVHVLGGDVVRAIETGAVDDEDVVADSTAIQETAGEI
                   :: :  *..:*  :*  *.*  * :.::       :  * :    :.     :       

966|gene|hut       VRADGHNIDLSQSTVFGYSASSLTRHPVSVVLDAAEDIGADFIVIPRQSVMDEPGAMLGK
12221|hp|hma       FRD-AHDGVFETSSATAFSETRLMQTPGSVVLDVAEDLDSDFIVVPRE---EGSEEAVGR
2693|gene|hhi      FRD-VHDGTFETSSATAFSETRLMQTPGSVVLDVAEDVDADFIVVPREE-RSEGEEAVGR
1718|gene|nph      AGT----VPVDHSSACGFSTCRLSQHPGSVILDVAEMLAVDFVVVPRQPVTGDEEAVIEK
2521|hp|nrc1       APD---GVAVDSSIAYGFSTSRKRQHPGSVILDAAADIDADFVVIPREGMREETGDVLER
1065|gene|hwa      AAK--YDISASTSVVYGFSTQIKTTHPGRVVLDTAEDLNADFLVVPRKPLSGDPGEVLSR
1930|gene|hla      AEA--AGIAHSNSIAYGFSTKVKTVHPGSVVLDTAEELESDFIVVPREPVSGDPGEVLGK
3850|gene|hbo      AAR--YDVELATSVAYGFSTKMKLRHPGSVVLDTAEELGADFVVVPREPVSGDPGEVLAK
                               * . .:*       *  *:**.*  :  **:*:**:         : .

966|gene|hut       VAEYVLTYASQPVLSV
12221|hp|hma       AAIYVIEYASQPVLTV
2693|gene|hhi      AAIYVIEYASQPVLTV
1718|gene|nph      AAEYVIAYASQPVLSV
2521|hp|nrc1       AAEYVLLYASQPVLSV
1065|gene|hwa      AAEYVLLYASQPVLSV
1930|gene|hla      AAEYVLLYASQPVLSV
3850|gene|hbo      AAEYVLLYASQPVLSV
                   .* **: *******:*