HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0235COG0318KOG3628 KOG1176 KOG1179arCOG00856Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases IIlong-chain fatty-acid-CoA ligase

HOG Organism Gene ID Name Annotation
cHOG0235 nrc1 VNG1073 lfl1 long-chain fatty-acid-CoA ligase
cHOG0235 hmu HMUK2248 Hmuk_2248 O-succinylbenzoate-CoA ligase( EC:6.2.1.26 )
cHOG0235 hma RRNAC0843 menE O-succinylbenzoic acid-CoA ligase
cHOG0235 hwa HQ2402A menE O-succinylbenzoic acid--CoA ligase
cHOG0235 hla HLAC1497 Hlac_1497 AMP-dependent synthetase and ligase
cHOG0235 hbo HBOR18630 Hbor_18630 O-succinylbenzoate-CoA ligase( EC:6.2.1.26 )
cHOG0235 hut HUTA0392 Huta_0392 O-succinylbenzoate-CoA ligase
cHOG0235 hvo HVO_1375 HVO_1375 menE O-succinylbenzoate-CoA ligase
cHOG0235 nph NP2738A menE O-succinylbenzoic acid--CoA ligase
cHOG0235 hhi 1483 menE O-succinylbenzoic acid-CoA ligase
MUSCLE (3.6) multiple sequence alignment


392|gene|hut        ---------------------MRTLDAWPQVDPLTARASSTPDRTAVIESETGERWTYEE
1073|gene|nrc1      -----------------------------MRDEVTLQATTNPDRPALVDAATDRTWTYDA
2738|gene|nph       -----------------------------MRDWLAVRADATPGATAL-AVADGPDRSYDE
10843|gene|hma      MVRCRSPSRPVWESIRQRWGPMRDPLNWPTQDLVTHRADTTPDRTAMVAAASGNAVTYRK
1483|gene|hhi       ---------------------MRDPLNWPTQDLVTHRADTTPDRTAMVAAASGNAVTYRK
1497|gene|hla       -----------------------------MRDWLSHRVVSSPDDTALIRAEDGEAWTYTD
2402|gene|hwa       -----------------------------MRQWLSQRAETSPTACALIDAETGDNYTFAA
18630|gene|hbo      -----------------------------MRDWLSHRARTSPDATALVRAVTGEAWDFTE
                                                   : :: .. :.*   *:     .    :  

392|gene|hut        LFDEADWLAGRIAAACEGRPDRLGIAMETGIDFVRATHAAWRLGTAIVPLDTREPTEQLD
1073|gene|nrc1      LDSAVDATAGSLAALGVTPGDRVAVLLETRPAFATLVFAAARLGAVLVPLNARLSQPELA
2738|gene|nph       LDERVEVLAGRLAALGVGVGDTVAVCLETRHEFVVVVHALQRLGAVLVPLHTEQTPPELR
10843|gene|hma      LDAAVDAVAAELDRRVDAPDATVATLLPTRPAVGTLLFAAMRLGATLAPLNVELDAATLQ
1483|gene|hhi       LDAAVDAVAAELDRRVDAPDATVATLLPTRPAVGTLLFAAMRLGATLAPLNVELDAATLQ
1497|gene|hla       LDRLVSETADRLVAHGIEADDRLGVLTPPYVGTVGLVHAAMRIGATFVPLGQELTERELT
2402|gene|hwa       LDQAVERLAGRLITLGVSQGDRLGIVLSPRVESVLIFYAAARIGATAVPLGHRLTATEIE
18630|gene|hbo      LDGMVDEMAGRLVALGVAPGDHVGVVLQPRVEYVTLIHAAMRLGVTLVPLGDRLTARELA
                    *   ..  *  :          :.    .        .*  *:*.. .**        : 

392|gene|hut        FLAEKAAVDAIVATDRTAEAIADI-------EGCPVFSVDETDVSGVAALPAHDGGT---
1073|gene|nrc1      TQADAVAPVAVICGRDTATAADRL--------DAPAVRVADDAT--VRPLSGTDPDA---
2738|gene|nph       TRLSAVPPEAAVCGAATEAALTDA-------AETTVVTVDEPTAD-ARPLSGVTPEP---
10843|gene|hma      SQLSTVDADLLVCGDSTASLAADI-------DGCPTVSVDRELSAAAVADETAAAGSADE
1483|gene|hhi       SQLSTVDADLLVCGDGTASLAADI-------DGCPTVSVDRELSAAAVADETAAAGSADE
1497|gene|hla       ERVERADLDAVVCAEPTEGAALGAVEECEGGDEIPVLSVDDPAAEAVTAVHSVDPGP---
2402|gene|hwa       TRLTHATVQTVICGRSADKTVFEAATAIE--NDISIISMDKSTIDSVDSVENTIPAG---
18630|gene|hbo      EQIETADVTVLVCGAETEARAVEAT------DDVPLLSVESTTTTEVVSLTSVLPDP---
                         .     :.   :                 . . :       . .           

392|gene|hut        -----TPRARYPSDTHLIMFTSGTTGEPTGVKLTLTNLFASAIASAFRLGLTRRDRWLVS
1073|gene|nrc1      ----VTPVDSAWDDTRLLLFTSGTTGDPTAVRLTYRNLAASAAASAARLGVLPDDRWLCP
2738|gene|nph       ----FDLPEWALDEPLAVLFTSGTTGEPKGVVLTLGNVLASATASAFRLGVQRGDCWHVP
10843|gene|hma      TATDVTPAPLSRTDTQLVIFTSGTTSEPKGVRLTVGNLVASAVASSYRLGVLPDDRWLVC
1483|gene|hhi       TATDVTPAPLSRTDTQLVIFTSGTTSEPKGVRLTVGNLVASAVASSYRLGVLPDDRWLVC
1497|gene|hla       ----VEPPEWATTDYLCILFTSGTTGDPKPVPLTAGNVYSSAVASAFRLGVDHEDRWLVS
2402|gene|hwa       ----VNTATWNSQRTQLLLFTSGTTGSPKAVKLTAGNILWSAVASAFRVGITPDEQWLVT
18630|gene|hbo      ----IPPASWSLADVQLLLFTSGTTGEPKAVKLTMGNLLASATASMFRLGFDPDDRWLVT
                                     ::******..*. * **  *:  ** **  *:*.   : *   

392|gene|hut        VPMVHMGGLAPLVRSTLYGTSVVLQRE--FEPAETAAVIRDFDVTGISFVPTMLSRLLEE
1073|gene|nrc1      LSMYHTGGVSVVLRTALYGTTAVLTRTPGFDAAAVGDALETHDCTGVSLVPPMLDRLVEA
2738|gene|nph       LPMYHMGGLAPVYRSVLYGTALSVQST--FDAEATAERLRNVEATAVSLVPTMLERLIAV
10843|gene|hma      LPTYHMGGLAPFIRSALYGTAAVVQRS--FDADATQQVLAEHGVTGVSLVPTMLSRLLDA
1483|gene|hhi       LPTYHMGGLAPFIRSALYGTAAVVQRS--FDADATQQVLAEHGVAGVSLVPTMLSRLLDA
1497|gene|hla       LSLHHMGGLAPVYRSALYGTTLVLQEG--FSPGGTADDIDTYDVTGISLVPTMLQQMLDR
2402|gene|hwa       LPLHHMGGIAPILRGPLYGMTVVLRGE--FDAEQAVADLHQYDITAVSLVPTMLRRMLNS
18630|gene|hbo      LSLHHMGGIAPVLRMPLYGMTVVLRDE--FDAGAAADDIDRYDVTAVSLVPTMLRRMLDS
                    :.  * **:: . *  *** :  :     *..  .   :     :.:*:**.** .::  

392|gene|hut        --RWSPPDLLRFVLLGGAAAPRDLIERSEAAGVPAYPTYGMTETASQVATATPTQAFENP
1073|gene|nrc1      ---DAVPDSLRFALVGGAPTPPELVERACAAGVPVCPTYGATETASQAATLHASDAPAHP
2738|gene|nph       ---GDLPD-LRFALVGGAPCPASLVERAHDRGVPVAPTYGMTEAASQIATAAPSMARAHP
10843|gene|hma      --GWEPPASLRFVLLGGGPASETLIERCRERDVPVYPTYGMTETASQIATARPETAFEHA
1483|gene|hhi       --GWEPPASLRFVLLGGGPASETLIERCRERDVPVYPTYGMTETASQIATARPETAFEHA
1497|gene|hla       --RGTLSDTLRVALLGGAPAPDELIERCRDYSIPVYPTYGMTESASQITTATPRQTKGRL
2402|gene|hwa       ANKSSFPETLRTVLLGGAPTPTALINQCQDESIPVCPTYGLTETASQVATARPQTAFNNP
18630|gene|hbo      --RGTLASSLRTVLLGGAPAPRELVERCRDYSIPVYPTYGMTETSSQVATARPDEAFDHV
                          .  ** .*:**.. .  *::..   .:*. **** **::** :*  .  :  . 

392|gene|hut        GTVGQPLMFTKVAII--DDGDSCAPGETGEIVIDGPTVTPGYL-DDEAT-----------
1073|gene|nrc1      ESVGRPLLGTTVTVVEPDTHTPVPDGQAGLLAVSGPTVTPGYA-GEGT------------
2738|gene|nph       HSVGYPLMFAEVTVVN-DEGVGCEPGTVGDIVVDGPMVTPGYL-DDETT-----------
10843|gene|hma      GTVGQPLVFTDVTVV--ADGAACDPGERGEIVVDGPTVTPGYLNGDDD------------
1483|gene|hhi       GTVGQPLVFTDVTVV--ADGAACDPGERGEIVVDGPTVTPGYLNGDDD------------
1497|gene|hla       GTVGRPIFGTDVTVVD-ENGTPVEPGETGEIVVDGPTITPGYIDGAGAQRGSDNTRTGGG
2402|gene|hwa       DTVGTPLLWSDITIVD-ESGSPQPAGSPGEIVVDGPTVTPGYA-GPETM-----------
18630|gene|hbo      GTVGRPLFWTDVTVVN-EDGDRLPPGETGEFVVSGPTVSPGYYNNPEAT-----------
                     :** *:. : ::::          *  * :.:.** ::***  .               

392|gene|hut        -------------RRVFDERGLHTGDLGYRDEHGRLYVVGRIDDRIVTGGENVDPGGIQS
1073|gene|nrc1      --------------APRCEHGLLTGDRGWIDADGFLHVGGRASDEIITGGENVRPEAVAA
2738|gene|nph       -------------AARFTARGLRTGDRGYRDDDGRLHVVGRSDDTIVTGGENVDPTEVEA
10843|gene|hma      ---------------AFSDHGFRTSDIGYRDADGHLWVEGRVDDQIVTGGENVDASTVAD
1483|gene|hhi       ---------------AFSDHGFRTSDIGYRDADGHLWVEGRVDDQIVTGGENVDASTVAD
1497|gene|hla       KNGADGSNTAALDRSSFGSHGLHTGDVGCFDDEGYLYVLNRLDDRIITGGENVEPGEVID
2402|gene|hwa       ---------------TTGAYGFHTGDIGILDTNGRLTVVNRLDDRIVTGGENVDPGEVTT
18630|gene|hbo      -------------AAAFDERGLHTGDVGYVDEGGRLYVLNRVDDRIVTGGENVDPGEVAD
                                        *: *.* *  *  * * * .* .* *:****** .  :  

392|gene|hut        VIESHPGVAESVVVGIPDEEWGERVGALVV------------------------------
1073|gene|nrc1      VLREHPAIEAVAVVGVPDDAWGDRVGALVV------------------------------
2738|gene|nph       ALRAHSAVDACAVVGLADDEWGQRVAALVV------------------------------
10843|gene|hma      TIREHPAVEDAAVVGLPDEEWGQRVAALVV------------------------------
1483|gene|hhi       TIREHPAVEDAAVVGLADEEWGQRVAALVV------------------------------
1497|gene|hla       VLREFPSAEDAAVVGLDDDVWGERVSALLAVGDRLRDTEVTAEGPTGVDGLDESDEPDGG
2402|gene|hwa       VLESHPAVAAAAVVGIPDSDWGERVVAAVT------------------------------
18630|gene|hbo      VLRSHPDVHDVAVVGIPDAEWGECVSALVV------------------------------
                    .:  ..     .***: *  **: * * :.                              

392|gene|hut        PQND---TEPDS---------------------------DEIESLCREELASFKVPKSIA
1073|gene|nrc1      PADDTADVSVAS-----------------------------LRAFCDGRLAGYKHPRVVA
2738|gene|nph       SDGDD--TTPDA-----------------------------LREHCRERLAGYKLPRTIG
10843|gene|hma      GD-----VSPTA-----------------------------VRDHCAERLAPYEVPKTVR
1483|gene|hhi       GN-----VSPEA-----------------------------VRDHCAERLAAYEVPKTVQ
1497|gene|hla       DDDDREPTDPDGGDESRPDENGSDKEGPDESDAAPLVDDEQLVSFVRDRLAGFKIPKTVA
2402|gene|hwa       PVMTERAVSNDD-----------------------------LRSHARDYLAGFKIPKQIR
18630|gene|hbo      SDTDE--LDRSG-----------------------------LRDFAREQLAGFKIPRVIA
                                                             :       ** :: *. : 

392|gene|hut        IGEAIPRTVSGTVDREAVIERIRHR-----------------------------------
1073|gene|nrc1      AVDALPRTASGTVDRQAAVAEL--------------------------------------
2738|gene|nph       VVDALPRTASGTVDRDAARDRL--------------------------------------
10843|gene|hma      IADALPRTASGTVDRAAVRSHF--------------------------------------
1483|gene|hhi       AVDSLPRTASGTVDRAAVRSHF--------------------------------------
1497|gene|hla       YVDELPRTVSGTVDREAVRRILRDRGYDPRRDADLETAGFEPAEPTEPAGPDDPDDPATA
2402|gene|hwa       VVDTLPRTISGTINRDAVHELFMTD-----------------------------------
18630|gene|hbo      FADELPRTVSGTVEREAVREQLIER-------------------------------REAV
                      : :*** ***::* *.   :                                      

392|gene|hut        ------------------------------------------------------------
1073|gene|nrc1      ----------------------RDDAAP--------------------------------
2738|gene|nph       ------------------------SECQ--------------------------------
10843|gene|hma      ------------------GTASESNESA--------------------------------
1483|gene|hhi       ------------------GTASESNESA--------------------------------
1497|gene|hla       PATSNDREETGDGERVDDGGTDDDDETDDQSVGDDSRDGEGSGDDGSGDDGGDGDEDAAE
2402|gene|hwa       ------------------AAVTPEDE----------------------------------
18630|gene|hbo      AGDTDESDEREAGDVGDAGSVSGEDDAGEKEAEDDEKVNDEKVDETDAEGDLGTNTEARA
                                                                                

392|gene|hut        -----------
1073|gene|nrc1      -----------
2738|gene|nph       -----------
10843|gene|hma      -----------
1483|gene|hhi       -----------
1497|gene|hla       RSEAIDDRVGG
2402|gene|hwa       -----------
18630|gene|hbo      DGTQSSSNTDN