HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0234COG1474KOG2227 KOG1514arCOG00467/1Cdc6-related protein AAA superfamily ATPaseorc / cell division control protein 6

HOG Organism Gene ID Name Annotation
cHOG0234 nrc1 VNG2411 orc7 orc / cell division control protein 6
cHOG0234 hmu HMUK0815 Hmuk_0815 orc1/cdc6 family replication initiation protein
cHOG0234 hma RRNAC2711 cdc6d cell division control protein 6-like
cHOG0234 hwa HQ1001A cdc6_1 cell division control protein cdc6-like protein
cHOG0234 hla HLAC0001 Hlac_1 orc1/cdc6 family replication initiation protein
cHOG0234 hbo HBOR02110 Hbor_02110 ORC complex protein Cdc6/Orc1
cHOG0234 hut HUTA1613 Huta_1613 orc1/cdc6 family replication initiation protein
cHOG0234 hvo HVO_0001 HVO_0001 orc cell division control protein 6-like
cHOG0234 nph NP0596A cdc6_1 cell division control protein cdc6-like protein
cHOG0234 hhi 1 cdc6a putative cell division control protein 6
MUSCLE (3.6) multiple sequence alignment


1001|gene|hwa       ---MHNNRIHNNSSSDNLESSHENKRDSQSTSPTESGDFTLDEDMSQDNNHSDTANSNTR
596|gene|nph        ---MTNDDTASEPRTQDRLERGSGDTDEDSEDTVDIDTDTEGSDDVATPSQSSGSPVETG
1|gene|hla          MDEGENTPQADESKDNSGITGDRSGTDQVDETDGSDETDANLDDPPSPGSTNSDLNTDLQ
2110|gene|hbo       MDDDTPKRDDGTRQINHSDTDDVASTEDDSSSAASGGNTTSGEPVSGDAKSEEALDGE-G
2411|gene|nrc1      ---MTDDRSTDERRT-----------------------------------ADRDFEVD--
1613|gene|hut       MQDTEDESNSPVTEDSLTDDHSEPSTGGVVDPPAGTDRSGGDSDPDSPDESDPAPDVE-D
12711|gene|hma      ---MTDKSNNPAPASDPSTTETSNDADG----------------------SDGQLDAETD
1|gene|hhi          ---MTDESDNSAPASDPSTTETSNDVDG----------------------SDEQLDVETD
                                                                       .     :  

1001|gene|hwa       NRTSSASEDDID------------------------------------------------
596|gene|nph        GFSEDESDSERTDSVPTGSEHARNVDGFSGDIDL------------------EDLDLAPD
1|gene|hla          SDPETDVSTDIDVGSGGRDRSSPDVD--------------------------FDGVVL--
2110|gene|hbo       SPTDENPATDDDEPVTAEDIDIRESIGPSGSTDGETDDDSSTDVS-------LDEVVL--
2411|gene|nrc1      ----------------------------------------------------LDDVL---
1613|gene|hut       DGAGGGLSHESDPPDSNRNGDDDPVDEDWTTRPSEESFGSSVEATPSDTAGSIDTDLLDE
12711|gene|hma      PGTSTGPSD-------------------------------------------LDDVILDN
1|gene|hhi          SGASTGPSD-------------------------------------------LDDVILDN
                                                                                

1001|gene|hwa       ------HSENREEQGLFDNLLSGEPIFENKEVLRPSYTPRKLPHRTEQINQMATILVSAL
596|gene|nph        DETEEDGEADEASRGLFDDLLEGEPIFENKEVLRPSYTPHKLPHREEQINNMATILVTAL
1|gene|hla          -------DDDDDNQGLFDDLLSGEPIFENKEVLRPSYTPHELPHRNDQINRMATILVSAL
2110|gene|hbo       ------DDGGSDSRGLFDDLLSGEPIFENKEVLRPSYTPHELPHRTEQINQMATILVSAL
2411|gene|nrc1      -------DDEDDDEGLFDDLLSGEPIFENKEVLRPSYTPHELPHRNDQINNMATILVAAL
1613|gene|hut       IVFEDEEDADEASRGLFDDLLSGEPIFENKEVLRPSYTPRKLPHREEQINNMATILVAAL
12711|gene|hma      LDAGSDDPSDEASRGLFDDLLEGEPIFENKEVLRPSYTPHKLPHREEQINNMATILVTAL
1|gene|hhi          LDAGSDDPSDEASRGLFDDLLEGEPIFENKEVLRPSYTPHKLPHREEQINNMATILVTAL
                                . ****:**.*****************.:**** :***.******:**

1001|gene|hwa       RGDTPSNILIYGKTGTGKTASAKFVSQELESTSQKYDVACEVEYINCEVTDTQYRVLAQL
596|gene|nph        RGETPSNILIYGKTGTGKTASAKFVSEELETTSQKYEVPCEVQYINCEVTDTQYRVLAQL
1|gene|hla          RGETPSNILIYGKTGTGKTASAKFVSQELESTSQKYDVPCEVEYINCEVTDTQYRVLAQL
2110|gene|hbo       RGETPSNILIYGKTGTGKTASAKFVSQELESTSQKYDVPCEVEYINCEVTDTQYRVLAQL
2411|gene|nrc1      RGETPSNILIYGKTGTGKTASAKFVSQELEKTSKKYDVPCEVEYINCEVTDTQYRVLAQL
1613|gene|hut       RGDTPSNILIYGKTGTGKTASAKFVSEELERTSAKYEVPCDVEYINCEVTDTQYRVLAQL
12711|gene|hma      RGDTPSNILIYGKTGTGKTASAKFVSEELETTSQKYEVPCEVEYINCEVTDTQYRVLAQL
1|gene|hhi          RGDTPSNILIYGKTGTGKTASAKFVSEELETTSQKYEVPCEVEYINCEVTDTQYRVLAQL
                    **:***********************:*** ** **:*.*:*:*****************

1001|gene|hwa       ANKFIEKNRNQIDKRIDELKTLQSSDQYLSGSASSAESIDSVDT----ADDTISKSPDES
596|gene|nph        ANKFIEKNEAYIESRLDELEALRD---------RAAEDPAALD-----------------
1|gene|hla          ANTFIEKNQAVIADQLERCRELRS---------AAADAPAALA-----------------
2110|gene|hbo       ANKFIEKNFDVIENELDRLEDLRT---------RARDTPDLLA-----------------
2411|gene|nrc1      ANTFIDQNRAFVDARIADLSDLRA---------QADDDPNALEIGGSPGDDRTGNESSEG
1613|gene|hut       ANTFIENNEAHIEDRLAELEDLQD---------RAEADPNELE-----------------
12711|gene|hma      ANKFIDKNAQLIDDRIAELEELQS---------QARENTAALE-----------------
1|gene|hhi          ANKFIDKNAQLIDDRIAELEDLRS---------RARENAAALE-----------------
                    **.**::*   :   :     *.           :      :                  

1001|gene|hwa       TGEYLNLSDIASPFDSARDLDDRIESLRADREEMELVPMTGWPTDRVYSTFFDAVDYHER
596|gene|nph        ----------DTEFDSVAAVEAEIDTLETDLEEFDPVPMTGWPTDRVYSTFFDAVDYHER
1|gene|hla          ----------DTEFATLDDLDARIDELETDAEEMEEVPMTGWPTDRVYSTFFEAVDYHER
2110|gene|hbo       ----------DTSFDSLDGVEERIEQLETDCEEMETVPMTGWPTDRVYSTFFDAVDYNER
2411|gene|nrc1      SDVSDSFSDLRERFDSVAEIDDRIDSLEADKAEMEQVPMTGWPTDRVYATFFDAVDYVER
1613|gene|hut       ----------GTEFATLEAVSAEIESLEDDLASFETVPMTGWPTDRVYSTFFDAVDYTER
12711|gene|hma      ----------ETAFGSLDDVEAEIESLEADKSEFEEVPMTGWPTDRVYSSFFDAVDYHER
1|gene|hhi          ----------ETAFDSLDDIETEIESLEADKAEFEEVPMTGWPTDRVYSSFFDAVDYHER
                                 * :   :.  *: *  *  .:: ************::**:**** **

1001|gene|hwa       VAVIMLDEVDKLVEKSGDDTLYNLSRMNSELDNSRISIIGISNDLKFTDFLDPRVKSSLG
596|gene|nph        VVVIMLDEIDKLVEKSGDDTLYNLSRMNSELSNSRVSIMGISNDLKFTDFLDPRVKSSLG
1|gene|hla          VVVIMLDEIDKLVEKSGDDTLYNLSRMNSELNRSRISIMGISNDLKFTDFLDPRVKSSLG
2110|gene|hbo       VVVIMLDEIDKLVEKSGDDTLYNLSRMNSELSNSRISIMGISNDLKFTDFLDPRVKSSLG
2411|gene|nrc1      VAVIMLDEIDKLVEKSGDDTLYNLSRMNSELDNSRVSIIGISNDLKFTDFLDPRVKSSLG
1613|gene|hut       VVVIMLDEIDKLVEKSGDDTLYNLSRMNSELENSRVSIMGISNDLKFTDFLDPRVKSSLG
12711|gene|hma      VVVIMLDEIDKLVEKSGDDTLYNLSRMNSELENSRVSIMGISNDLKFTDFLDPRVKSSLG
1|gene|hhi          VVVIMLDEIDKLVEKSGDDTLYNLSRMNSELENSRVSIMGISNDLKFTDFLDPRVKSSLG
                    *.******:**********************..**:**:*********************

1001|gene|hwa       EEEIVFPPYDANQLRDILQYRADVSFKSDALTDDVIPLCAAFAAQEHGDARRALDLLRTA
596|gene|nph        EEEIVFPPYDATQLRDILQHRAEIAFKPDTLSDDVIPLCAAFAAQEHGDARRALDLLRTA
1|gene|hla          EEEIVFPPYDANQLRDILQHRADISFKQDALTDDVIPLCAAFAAQEHGDARRALDLLRTA
2110|gene|hbo       EEEIVFPPYDANQLRDILQHRADVAFKSGALTEDVIPLCAAFAAQEHGDARRALDLLRTA
2411|gene|nrc1      EEEIVFPPYDANQLRDILQHRSDVAFKADALSDDVLPLCAAFAAQEHGDARRALDLLRTA
1613|gene|hut       EEEIVFPPYDANQLRDILQARADVAFKDDALSEDVIPLCAAFAAQEHGDARRALDLLRTA
12711|gene|hma      EEEIVFPPYDANQLRDILQARSDVAFKGDALTEDVIPLCAAFAAQEHGDARRALDLLRTA
1|gene|hhi          EEEIVFPPYDANQLRDILQARSDVAFKGDALTEDVIPLCAAFAAQEHGDARRALDLLRTA
                    ***********.******* *::::** .:*::**:************************

1001|gene|hwa       GELAERSQTNTVEEDHVRQAQDKIELDRVIEVVRTLPTQSKIVLYSIILLEKNGVHSINT
596|gene|nph        GELAERDRTETITEKHVRKAQEKIELDRVVEVVRTLPTQSKLVLYATILLEKNGVHNINT
1|gene|hla          GELAERSQAEIVAEKHVRQAQDKIELDRVVEVVRTLPTQSKIVLFAVILLEKNGVHNINT
2110|gene|hbo       GELAERGQADTVEEAHVRQAQDKIELDRVVEVVRTLPTQSKIVLFAIILLEKNGVRNINT
2411|gene|nrc1      GELAERDQAENVTEDHVRRAQDKIELDRVVEVVRTLPTQSKLVLYAILLLEDNGVHNVNT
1613|gene|hut       GELAERDQIDLVAEDHVRQAQEKIELDRVVEVVRTLPTQSKLVLFSIILLEKNGVHNINT
12711|gene|hma      GELAERDQTDNVLEDHVRQAQEKIELDRVVEVVRTLPTQSKIVLFAIILLEKNGVHNINT
1|gene|hhi          GELAERDQTDNVLEDHVRQAQEKIELDRVVEVVRTLPTQSKIVLFAIILLEKNGVHNINT
                    ******.. : : * ***.**:*******:***********:**:: :***.***..:**

1001|gene|hwa       GEVFNIYKRLCEELDTDVLTQRRVTDLISELDMLGIVNAIVVSKGRYGRTKEISLSVPIE
596|gene|nph        GEVFNIYKRLCEEIDADVLTQRRVTDLISELDMLGIVNAVVVSKGRYGRTKEISLSVPLD
1|gene|hla          GEVFNIYKRLCEEIDADVLTQRRVTDLISELDMLGIVNAVVVSKGRYGRTKEMGLSVPVE
2110|gene|hbo       GEVFNIYKRLCEEIDADILTQRRVTDLISELDMLGIVNAVVVSKGRYGRTKEISLSVPID
2411|gene|nrc1      GEVYNIYKTLCDELDADVLTQRRVTDLISELDMLGIVNAVVVSKGRYGRTKEISLSVPVE
1613|gene|hut       GEVYNIYKRLCEEIDADVLTQRRVTDLISELDMLGIVNAVVVSKGRYGRTKEISLSVPQD
12711|gene|hma      GEVFNIYKNLCEEIDADILTQRRVTDLISELDMLGIVNAVVVSKGRYGRTKEISLSVPTE
1|gene|hhi          GEVFNIYKNLCEEIDADILTQRRVTDLISELDMLGIVNAVVVSKGRYGRTKEISLSVPTE
                    ***:**** **:*:*:*:*********************:************:.**** :

1001|gene|hwa       ETETVLLSDSRLGNIENAQPFVQARFDN-
596|gene|nph        ETEAVLLSDSRVGEVEDAQPFVQARFDN-
1|gene|hla          ETEAVLLSDSRLGDIENAQPFVQARFDN-
2110|gene|hbo       ETEAVLLSDSRLGDIENAQPFVQARFDN-
2411|gene|nrc1      ETEAVLEADSRLSDIEDITPFVQARFENN
1613|gene|hut       ETEAVLHSDSRLGDIEDVQPFIQARFDQ-
12711|gene|hma      ETEAVLLSDSRLGDIDDVQPFVQARFDN-
1|gene|hhi          ETEAVLLSDSRLGDIDDVQPFVQARFDN-
                    ***:** :***:.::::  **:****::