HOG Organism Gene ID Name Annotation
aHOG2338 hbo HBOR20590 Hbor_20590 hypothetical protein
aHOG2338 nrc1 VNG1420 vng1420 no entry
MUSCLE (3.6) multiple sequence alignment


20590|hp|hbo      --------------------------------MSRADAAELQDAIGAAITEKQEFFRTAG
1420|hp|nrc1      MRLVEKFAGSPDCWAERRGDRVVVSVDGDELVLPTDDAEQLRDSLSDALTARESFMNTAG
                                                  :.  ** :*.*::. *:* .:.*:.***

20590|hp|hbo      EHRMDGSYVVSRRGADSAGNTKVFDSFDALRRLFDRLPDEFTADDVSRTGITGSRRHMVV
1420|hp|nrc1      VRRPDGSYVVERRGADSAGNRKVFESFDALRGRCRRPPETFTAEDLSATGLTAGRRHMVL
                   .* ******.********* ***:******    * *: ***:*:* **:*..*****:

20590|hp|hbo      RHFGEHPAFDCDIAQRNPLTVVKTDAADAGAGEAADVTAD
1420|hp|nrc1      WHLVEHPAFPVALASRQPLTAEKT---------ATEVAEP
                  .*: *****   :*.*:***. **         *::*: