HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0232COG0165KOG1316arCOG01748Argininosuccinate lyaseargininosuccinate lyase

HOG Organism Gene ID Name Annotation
cHOG0232 nrc1 VNG2436 argH argininosuccinate lyase
cHOG0232 hmu HMUK0770 Hmuk_0770 argininosuccinate lyase( EC:4.3.2.1 )
cHOG0232 hma RRNAC2681 argH argininosuccinate lyase
cHOG0232 hwa HQ3712A argH argininosuccinate lyase
cHOG0232 hla HLAC2618 Hlac_2618 argininosuccinate lyase
cHOG0232 hbo HBOR01710 Hbor_01710 argininosuccinate lyase( EC:4.3.2.1 )
cHOG0232 hut HUTA1504 Huta_1504 argininosuccinate lyase
cHOG0232 hvo HVO_0048 HVO_0048 argH argininosuccinate lyase
cHOG0232 nph NP5254A argH argininosuccinate lyase
cHOG0232 hhi 3085 argH argininosuccinate lyase
MUSCLE (3.6) multiple sequence alignment


3712|gene|hwa       MSEENPANAVNDTNETEPSD----NIGVVRRERFSGGPARGFLSSLAADERIFAADIAVD
2436|gene|nrc1      ----------------MTGG----GDPVVRRDRFSGGPARSFLSSMDGDGRIFEADLAVD
2618|gene|hla       MTDDDPGTAADAN---ATGE----SGTAVRRDRFSGGPAREFLSSLAADAAIFEADLAVD
5254|gene|nph       -------MTGDAD------E----GRDVVRRDRFSGGPARGFLSSLAADERIFEADLAVD
12681|gene|hma      MSDGEDHETANAD-----DR----DETVVRRDRFAGGPARSFLSSLSDDERIFAADLAVD
3085|gene|hhi       MSDGEDHETADADHAATAGDADRSGETVVRRDRFAGGPARSFLSSLSDDERIFAADLAVD
1710|gene|hbo       --------------MNEEGG----DEGVVRRDRFSGGPARGFMSSLAADERIFAADVAVD
1504|gene|hut       -MSEEPTANGDED--GGEDG----SEGVVRRDRFSGGPARGFLSSLSADERIFAADLAVD
                                            .  .***:**:***** *:**:  *  ** **:***

3712|gene|hwa       RAHVIMLIEQDIIDAATGESILTALDSVETAGHDELPDGEDVHEAIETAVIDRVGPAGGK
2436|gene|nrc1      RAHVVMLAEQDVIGDEAAAAILGALADVEAAGFDALPPGEDVHEAIETAVVEAVGRDGGK
2618|gene|hla       RAHTVMLAEQGIVDDTVAGEILTSLDDVEAAGHDALPDGEDVHEAIETAVIDRIGSDGGR
5254|gene|nph       RAHVVMLDEQDIIGTDDAAAILGALDDVEAAGHGSLTDGEDVHAAIETAVIERVGDRGGK
12681|gene|hma      RAHVVMLAEREIIDRETAGDVLAALADVEDAGHDALPDGEDVHEAIESAVIERVGPDGGK
3085|gene|hhi       RAHVVMLAEQEIIDRETAGDVLAALADVEDAGHDALPDGEDVHEAIESAVIERVGPDGGK
1710|gene|hbo       RAHVVMLEEQEIVESDVAAEILAALDDVESEGHAALPEGEDVHEAIETAVVEQVGPDGGK
1504|gene|hut       RAHVVMLAEQGIVEADTAGEILAALEEIEDAGHDALSEGEDVHEAIETAVIERAGPDGGR
                    ***.:** *. ::    .  :* :* .:*  *.  *. ***** ***:**::  *  **.

3712|gene|hwa       MHTARSRNDEVATCIRYRLRSDLLQAIDATLELKKILLEAGKVHTETIMPGYTHLQPAQP
2436|gene|nrc1      LHTARSRNDEVAACIRYRLRADLLDAIEVVVALRSALADVAAAEAETVMPGFTHLQPAQP
2618|gene|hla       MHTARSRNDEVATCIRYRLREDLLAAAEATIALREALVDVASEHTETVMPGYTHLQPAQP
5254|gene|nph       MHTARSRNDEVAACIRYRLREDVLAAVEATLEAREMLLDVAGDHTETVMPGFTHLQPAQP
12681|gene|hma      MHTARSRNDEVAACIRYRLREDILDLIETVVGAREQLIEVARAEDGTVMPGYTHLQPAQP
3085|gene|hhi       MHTARSRNDEVAACIRYRLREDVLDLVETVVGAREQLIDVARAERETVMPGYTHLQPAQP
1710|gene|hbo       MHTARSRNDEVATCIRYRLREDLLDAIEATLALREALVDAAEAEVETVMPGYTHLQPAQP
1504|gene|hut       MHTARSRNDEVATCIRYRLRADLLDAIEATLEARGALIETAEAERETVIPGFTHLQPAQP
                    :***********:******* *:*   :..:  .  * :..     *::**:********

3712|gene|hwa       ITVGHWLCSYAAGIERDTARLLDAYDRVNTSPLGAAAFAGTPFEIDRERTATLLGFDDVL
2436|gene|nrc1      TTVAHWALSYAGTLARDTGRLCDAYGRTNESPLGAAAFAGTTFGVDRERTAALLGFDGVV
2618|gene|hla       TTVAHYLLSYEGGVARDTERLLDAYDRVNRSPLGAAAFAGTPFDIDRDRTAELLGFDGTV
5254|gene|nph       TTVAHYLHSYASALARDTERLLDAYGRINRSPLGAAAFAGTPFDIDRERTAELLGFDGVV
12681|gene|hma      TTVAHWVLSYEQALQRDTGRLLDAYERVNQNPLGSAAFAGTPFDVDRERTAALLGFDSVA
3085|gene|hhi       TTVAHWVLSYEQALQRDTARLLDAYERVNQNPLGSAAFAGTPFDVDRERTAELLGFEGVA
1710|gene|hbo       TTVAHYLLSYEAAFARDTARLLDAYDRTNQSPLGAAAFAGTPFDIDRERTAELLGFDGVL
1504|gene|hut       TTVAHWALSYERALARETARLLDAYDRTNQSPLGAAAFAGTPFDIDRERTADLLGFEGTM
                     **.*:  **   . *:* ** *** * * .***:******.* :**:*** ****:.. 

3712|gene|hwa       ENTIDAVAARDSLIETLSALAAHAITLSGMAEDLIIFANKGYVKLADQYASTSSIMPQKV
2436|gene|nrc1      ANAADAAASRDFLLEAVSALASVAVTCSGLAADVVFFANRGFVEVSDDYASTSSIMPQKK
2618|gene|hla       RNSTDAASARDFLAEGATACATLATTLSGLAEDLILFSNKGFVELSDAYSSTSSIMPQKK
5254|gene|nph       RNSMDAASARDFLVETTAAAAGLATTLSGLAEDLVVFSKAGYVELDDAYASTSSIMPQKK
12681|gene|hma      ENSMDASATRDFLVETTSAVATLATTLSGLAEDVVVMASKGHVALDDDYASTSSIMPQKK
3085|gene|hhi       ENSMDASATRDFLVETTSAVATLATNLSGLSEDVVVMASKGHVTLDDDYASTSSIMPQKK
1710|gene|hbo       RNSMDASSARDFLLESVSALATHATTLSGLAEDLVIFSNKGFVELSDDYASTSSIMPQKV
1504|gene|hut       ANAMDAVSARDFLVESTAALATLATTLSGLAEDVVIYAKSGYVEVDDAYASTSSIMPQKK
                     *: ** ::** * *  :* *  * . **:: *::. :. *.* : * *:********* 

3712|gene|hwa       NPDTLELVRAVAGDVTGELTGLLTTLKGLPRAYNRDLQRATPHVWGAIDDTTETTAIIGG
2436|gene|nrc1      NPDTMELVRATAGDAVGAQQALATTLQGLPRAYNRDLQRATGHAWTAVDGVTSAVEVAAG
2618|gene|hla       NPDTLELTRGVAGDAIGEATGTLSLLKGLPRAYNRDLQRAHAGVFEIADDVREATEVAAG
5254|gene|nph       NPDTMELVRATAGDTAAGLNALLTILKGLPRAYNRDLQRAHPHAFEALDAVTEATEVAAG
12681|gene|hma      NPDTLELVRGRTGDAVAGLNGLLTNLKGQPRAYNRDLQRAGRHAWDAIDSVTESVEVAAG
3085|gene|hhi       NPDTLELVRGRTGDAVAGLNGLLTNLKGQPRAYNRDLQRAGRHAWDAIDSVTESVAVAAG
1710|gene|hbo       NPDTLELVRATAGDAASGLSGLLTTLKGLPRAYNRDLQRATPHAWDAVDSVSEATAVVAG
1504|gene|hut       NPDTLELVRARAGDAAAGLNGLLTTLKGLPRAYNRDLQRAGGHAWRAIDGVSEATEVAAG
                    ****:**.*. :**. .   .  : *:* ***********   .:   * . .:. : .*

3712|gene|hwa       AIKTAQWADEALESAAGDGFSTATGIADALAMAGIPFRTAHEVLAVATD--RAGNETPTV
2436|gene|nrc1      VVATAGWPADDLEAAAGEGFSTATGVADALAAGGLPFRTAHEVVALAAE---RGCEGATL
2618|gene|hla       AVATADWDEVTLADAAGEGFSTATGVADLLAMSGMPFRTAHEIVATAAETVSDDDSSAAA
5254|gene|nph       AVATADWKEPALSEAAGEGFSTATGVADLLAMEGVPFRTAHELVARAAE------AGGDY
12681|gene|hma      AVATADWPAETLEVAATDGFATATGVADLLAMAGVPFRTAHEVVAEAAAGLGPEEDAPDY
3085|gene|hhi       AVATADWPAETLEAAATDGFATATGVADLLAMAGVPFRTAHEVVAEAAAGLGSEEDAPDY
1710|gene|hbo       AVSSASWPEETLESAAGDGFSTATGVADALAMAGLPFRTAHEVVAAAAE---RAEGTPDL
1504|gene|hut       AIATAEWNDEALADAAGEGFSTATGVADALAMAGVPFRTAHEVVASAAE---VAGDDADF
                    .: :* *    *  ** :**:****:** **  *:*******::* *:            

3712|gene|hwa       ET-LNHAAEDILGESLFTYVDQDTIIDILDPVMNVSTRDSRGGPATAAVTATIEMYENNH
2436|gene|nrc1      DA-VAAATEAVTGEPLSAVVEPAAVADALDPVGSVAARDSAGGPAPAAVEAAVADVRDGI
2618|gene|hla       AAKVDEATRKVTGEPLSTHVSRDDVESALDPAASVASRDSAGGPAPEAVADELAAVETRI
5254|gene|nph       AA-LSAAAEDILGGPLSEHVDKAAVEAALDPESSVASRDSLGGPAPESMAAALSAAGQRL
12681|gene|hma      EA-LSGLAEDVLGEPLSTYVDRDALEAALDPTESVAMRDSRGGPAPDAVAEQVSVAVDAL
3085|gene|hhi       EA-LSAVAEDVLGEPLSAYVDRDALEDALDPAESVAMRDSRGGPAPDAVAEQVSVAEDAL
1710|gene|hbo       AT-LDASAEEVLDASLFEYVSRADVQQTLDPTHSVESRDSTGGPAPAAVTAQLDEATVEL
1504|gene|hut       DA-LDAAARDTLGESLTAYVDRETIEAALDPAESVASRDSAGGPAPEAVAEQIASARDDH
                     : :   :    . .*   *.   :   ***  .*  *** ****. ::   :       

3712|gene|hwa       TTQTTAHETRRNKITSANALLDQEVQEYV-----
2436|gene|nrc1      DADEAALAAERASLADAADALAAEVSGYV-----
2618|gene|hla       ETDSAALADERESLAAAAELLDTEVAEHV-----
5254|gene|nph       DADAEALRERRGALATAADERERVVSSYDSTAPE
12681|gene|hma      AADREVLADRRQAVSQAADRRQTEVDRYV-----
3085|gene|hhi       AADSEALTDRWQAVSQAADRRQTEVDRYV-----
1710|gene|hbo       NDHRTELNTRTDALESATEKLAAEVAVITRD---
1504|gene|hut       AADSDTLAERRTAIDDAAEKLQAEVETYV-----
                                 :  *       *