HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0230COG0244KOG0816 KOG0815arCOG04288Ribosomal protein L1050S ribosomal protein L10P

HOG Organism Gene ID Name Annotation
cHOG0230 nrc1 VNG1104 rpl10p 50S ribosomal protein L10P
cHOG0230 hmu HMUK2185 Hmuk_2185 ribosomal protein L10
cHOG0230 hma RRNAC1417 rplP0 acidic ribosomal protein P0
cHOG0230 hwa HQ2902A rplP0 acidic ribosomal protein P0
cHOG0230 hla HLAC2534 Hlac_2534 ribosomal protein L10
cHOG0230 hbo HBOR12240 Hbor_12240 LSU ribosomal protein L10P
cHOG0230 hut HUTA0255 Huta_0255 ribosomal protein L10
cHOG0230 hvo HVO_2756 HVO_2756 RplJ Acidic ribosomal protein P0 homolog
cHOG0230 nph NP4450A rplP0 acidic ribosomal protein P0
cHOG0230 hhi 1999 rplP0 acidic ribosomal protein P0/50S ribosomal protein L10E
MUSCLE (3.6) multiple sequence alignment


255|gene|hut        ---MSAESERKTEHIPEWKREEIDDVVEMIDAYDSVGVVDLAGIPSQQLQDMRRNLYGTA
11417|gene|hma      ---MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTA
1999|gene|hhi       ---MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTA
1104|gene|nrc1      ---MSAEEQRTTEEVPEWKRQEVAELVDLLETYDSVGVVNVTGIPSKQLQDMRRGLHGQA
4450|gene|nph       ---MSAEA-RKTETIPEWKQEEIDELVAFLERYESVGVVDITGIPSRQLQDMRRDLHGTA
2902|gene|hwa       MSNSATAAARRTDTIPEWKREEVDELVSFIDQYDSIGIVNVAGIPSRQLQSMRRDLYGSA
2534|gene|hla       -----MSSVRKTETIPQWKQEEVDELVDFIESFNSVGIVGVAGIPSRQLQAMRRELHGSA
12240|gene|hbo      --MSESESVRKTETIPEWKRIEVGELTDFLEEYQSVGVVSVTGIPSRQLQSMRRDLHGSA
                             * *: :*:**. *:  :. ::: ::*:*:*.::****.*** *** *:* *

255|gene|hut        EIRVSRNTLVERALNEVDEGLDTLVDFVSGHVGLIGTDDNPFSLYQQLEASKTSAPINAG
11417|gene|hma      ELRVSRNTLLERALDDVDDGLEDLNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAG
1999|gene|hhi       ELRVSRNTLLERALDEVDDGLEDLNSYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAG
1104|gene|nrc1      ALRMSRNTLLVRALEEAGDGLDTLTEYVEGEVGLVATNDNPFGLYQQLENSKTPAPINAG
4450|gene|nph       ALRVSRNTLMERALNEGGDGLGELVEHVEGQVGLIGTNDNPFGLYQQLEESKTPAPINAG
2902|gene|hwa       AIRMSRNTLTTRALEEVADGCEELTTFVAGQVALVGTNDNPFGLYKQLEASKTPAPISAG
2534|gene|hla       DVRMSRNTLTVRALEEVNDGVEELTQYVAGQVALIGTNDNPFGLFKQLEASKTPAPINAG
12240|gene|hbo      ELRMSRNTLVTRALEQVNDGLEELTDYVYGQVALVGTNDNPFGLYKQLEASKTPAPINAG
                     :*:*****  ***::  :*   *  .: * *.*:.*:****.*:::** ***.***.**

255|gene|hut        EVAPNDIEIPEGDTGIDPGPFVGELQSVGANARIQEGSIQVLEDSTVLEAGGEVSADLAN
11417|gene|hma      EVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLSDSTVLDTGEEVSQELSN
1999|gene|hhi       EVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLSDSTVLDTGEEVSQELAN
1104|gene|nrc1      EVAPNDIVVPEGDTGIDPGPFVGELQTIGANARIQEGSIQVLDDSVVTEEGETVSDDVSN
4450|gene|nph       EVAPNDIVIPEGDTGVDPGPFVGDLQQVGANARIEGGSIKVVEDSTVLSAGEEVSSDLSN
2902|gene|hwa       EVAPNDIVIPEGDTGVDPGPFVGELQQVGASARIMDGSIKVTEESQVLDSGEEVSSELSG
2534|gene|hla       EVAPNDVVIPEGDTGVDPGPFVGELQTVGAAARIQDGSIMVTEDSKVLEEGEVVDDDLAN
12240|gene|hbo      EVAPNDIVIPEGDTGVDPGPFVGELQQVGASARIMEGSIKVTEDSHVLDEGEVVSEELSN
                    ******: :******:*******:** :** ***  *** * .:* * . *  *. :::.

255|gene|hut        VLGELGIEPKEVGLDLRAVYAEGVLFEPEDLELDVEEYRSDIQAAASRARNLSVNAVYPT
11417|gene|hma      VLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPT
1999|gene|hhi       VLNELGIEPKEVGLDLRAVFADGVLFEPEELELDVDEYRSDIQAAAGRAFNLSVNADYPT
1104|gene|nrc1      VLSELGIEPKEVGLDLRGVFSEGVLFTPEELEIDVDEYRADIQSAAASARNLSVNAAYPT
4450|gene|nph       VLSELGIEPKEVGLDLRGVSSEGVLFSPEELDIDVESYRTDIESAASAARNLSVNAEYPT
2902|gene|hwa       VLAELGIEPKEVGLDLRGVFADDVLFEPDELELDIDAYQSDIQSAAAGARNLSVNASYPT
2534|gene|hla       VLTELGIEPKEVGLDLKGVYSEGVLFEPDELEIDVDEYEADIRSAAAAARNLSVNAAYPT
12240|gene|hbo      VLNELGIEPKEVGLDLRGVYSEGVLFEPDELAIDVEEYRADIQSAAAGARNLSINAGYPT
                    ** *************..* ::.*** *::* :*:: * :** :**. * ***:** ***

255|gene|hut        AQTGPALLQKARGEAKSLGVQASIESPDLADDLVSKADAQVRALVSQIDDDEALPEELQG
11417|gene|hma      ATTAPTMLQSARGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQG
1999|gene|hhi       ATTAPTMLQSARGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQG
1104|gene|nrc1      ERTAPDLIAKGRGEAKSLGLQASVESPDLADDLVSKADAQVRALAAQIDDEDALPEELQD
4450|gene|nph       ARTAPSMLAKAAGEAKSVGLSAAVESPDLADDLVSKADAQVRALAAQIDDEEALPEELQD
2902|gene|hwa       AQTTPTLLANAVSDAKALGVSASIEDPAVLPDLIAKADAQVQSIAANIDDEDALPEELQD
2534|gene|hla       AATAGTLLAKASGEAKSVGLFAEIESPDVVPDLIGKADAQLRSLAAQIDDEEALPEELQG
12240|gene|hbo      AQTAPTMLAKAAGEAKALGLFAAIEDPELVPDLIAKADAQLRTLAAQIDDEEALPEELRG
                      *   :: .. .:**::.: * :*.* :  **:.*****:.::.::***::******..

255|gene|hut        VEVDTASET------ATAEQADEEAEDDTEDATDEAEDAADDDDDDGDD-GGDALGAMFG
11417|gene|hma      VEADVATEE------PTDDQDDDTASEDDADADDAAEEADDDDDDD-ED-AGDALGAMF-
1999|gene|hhi       VEADVATEE------PTDDQDDDTASEDDADADDAAEEADDGDDDE--D-AGDALGAMF-
1104|gene|nrc1      VDAPAAPAG-----GEADTTADEQSDETQASEADDADDSDDDDDDDDGNAGAEGLGEMFG
4450|gene|nph       VEQPAAADSAAEADDEDDTGNVEQTDESDADDADDADDADDADEED-GD-GGDALGDMFG
2902|gene|hwa       IETPVQPEASSTTDQDVDQETDAGSDADSDESADGDDEAADTDDDDDDD-GAEGLGAMFG
2534|gene|hla       VEAAPAPET--------DDADEEEEQAEEEDDTDDAEAADDDADDG-DD-GGDGLGAMFG
12240|gene|hbo      VEAPAAAPA---------DEADEDESTDEEDTEAEADDTDDDDEDD-GD-GAEGLGAMFG
                    ::    .                  .    .     : : *  ::   : ..:.** **