HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0023COG0306arCOG02267Phosphate/sulphate permeasesanion permease

HOG Organism Gene ID Name Annotation
cHOG0023 nrc1 VNG0753 ylnA anion permease
cHOG0023 nrc1 VNG6196d phoT2 sodium dependent phosphate transporter
cHOG0023 hmu HMUK0857 Hmuk_0857 phosphate transporter
cHOG0023 hmu HMUK3255b Hmuk_3255 phosphate transporter
cHOG0023 hma RRNAC2527 ylnA anion permease
cHOG0023 hwa HQ2052A pitA phosphate permease-like protein
cHOG0023 hwa HQ3455A pitA phosphate permease
cHOG0023 hla HLAC1653 Hlac_1653 phosphate transporter
cHOG0023 hbo HBOR02480 Hbor_02480 phosphate/sulfate permease
cHOG0023 hbo HBOR02490 Hbor_02490 phosphate/sulfate permease
cHOG0023 hut HUTA1034 Huta_1034 phosphate transporter
cHOG0023 hut HUTA2328 Huta_2328 phosphate transporter
cHOG0023 hvo HVO_2996 HVO_2996 anion permease
cHOG0023 nph NP1270A tp33 phosphate/sulfate permease
cHOG0023 nph NP4804A tp34 phosphate/sulfate permease
cHOG0023 hhi 2957 ylnA anion permease
cHOG0023 hhi 1922 HAH_1922 hypothetical protein
cHOG0023 hhi 5106 pitA putative phosphate permease
MUSCLE (3.6) multiple sequence alignment


1922|hp|hhi         MSNLDHGKFTRVTTLFHSLLGLDVFLLFFTGYAIMFNDELWWMLTLMGGASGVTAIHRIT
6196|gene|nrc1      -------------MALSVVFVVGVAAAIFVGVNIGGSST----GVAFGPATGSDALSMRQ
4804|gene|nph       --------------MVEALLVVGVIASLFVGFNIGGSST----GIAWGPPVGAGIIKKTT
2328|gene|hut       --------------MVSLLLFVGLAAAGFVGFNIGGSST----GVAWGPSVGANVVSKTG
2480|gene|hbo       --------------MTETLVLVGLVVAVFVGFNIGGSNT----GVAFGPAVGSRTVSKFG
12527|gene|hma      --------------MVEVLFALGVLVAIFVGFNIGGSST----GVAFGPAVGSNTLSKLS
2957|gene|hhi       --------------MVEVLFALGVLVAIFVGFNIGGSST----GVAFGPAVGSDTLSKLS
1034|gene|hut       --------------MVEPLLVVGIVITAFVAYNIGGATT----GPAFGPAVGAGAIGKVG
753|gene|nrc1       --------------MISALLGVGLVVAAFVGFNVGGSTT----GPAFGPAVGADALSKPT
1653|gene|hla       --------------MVEALLLVGFVVAAFVGYNIGGATT----GPAFGPAVGADVLSKSG
1270|gene|nph       ---------------MELLLLVGILVAVFVGYNIGGATT----APAFGPAVGAGVLSKVA
3455|gene|hwa       --------------MVEVLLFIGVGVAVFVGFNIGGSST----GVAFGPAVGSGLVSKLF
2490|gene|hbo       --------------MVEILLVVGLLVAAFVGFNIGGSST----GVAFGPAVGSGLVSKLL
2052|gene|hwa       --------------MVILLAVVGIIVAIFVGFNIGGSST----GVAFGPAVGSRLVRKTT
5106|gene|hhi       --------------MVSLLLVLGLLVAGFVGFNIGGSST----GVAFGPAVGSKLVRKVT
                                      :  :..    *..  :             * . *   :    

1922|hp|hhi         GIGLVALVVF---W-ITLQIISPTGRSNFS---KILPSKGDVDAFIQDIQFVLGR-----
6196|gene|nrc1      ASGLMAVFVLLGGFTIGTNVVDALGADFIP-AEYFTLGASIGVLLFIGLGILIGNVLNVS
4804|gene|nph       AAGLMTVFVFLGGWTVGRNVMDTLSGQIIT--IELTLSAGVAILFFIGLGILAANIFGVP
2328|gene|hut       AAALMTGFVFLGGWTVGRKVIKTLGGDIVP-EAAFSIEASIVVLTFIGLGMLVANLYGVP
2480|gene|hbo       AGVLMGIFALFGGWTVGRRVVTTLGSDLII-GDPFTVAASVVILLFIGLALFVSNLFGIP
12527|gene|hma      AAALMTIFAMAGGLIVGPAVVESLGSDLVA--TQFSPLISIVVLFFIGVALFLSNVVGVP
2957|gene|hhi       AAALMTIFALAGGLIVGPEVVESLGSDLVE--TAFSPLISIVVLFFIGVALFLSNVVGVP
1034|gene|hut       AAALMSVSFFVGAWTIGREVVDTLGTELVTDPTIFSLPVSIAVLFFIGGALLIGNLSGAP
753|gene|nrc1       AAGLMTVFFFIGAWTLGRRVVDTLGTELLRQPGIFTLEASIGVLFFIGLALFVGNYAGVP
1653|gene|hla       AAALMSVFFFIGAGTLGQRVVTTLGEDLVTGGNVFTLETSIVVLFFIGGALFVGNFAGVP
1270|gene|nph       AAALMTVFFLAGGWTLGREVVDTLGEGIVP-GELFTLEASIVVLFFIGFALFISNSFGVP
3455|gene|hwa       AAGLMTTFALIGAWTAGREVIETMGGQIVP-RSQFTLAASVAVLFFVGIALLISNTFGVP
2490|gene|hbo       AAGLMTAFALLGGWTAGREVIKTMGGQIVP-QSEFTLAASVAVLFFVGFALLISNTFGVP
2052|gene|hwa       AGALFVGFAFFGAWTVGRNVIATMSSSIVP-AIQFTPIASVIVLFFTGISLLISNLYGVP
5106|gene|hhi       AAALFSVFAFIGAWTVGRNVIVTMSEGIVP-AAQFTPVAGVGVLFFTGLSLLVSNIYGVP
                    .  *.    :         :: . .   .     :    .     : .  :. ..     

1922|hp|hhi         ADERHPSARQFAGYKAD----EVPLLSYIGKGVVFIFSIELTLLAISGLLIWSKTGLAAM
6196|gene|nrc1      TSTSQTAVAAVVAMGAALGVLDWRTVGVVGMWWVLSTTLAFWICAFVGRYFYDAIVNLLS
4804|gene|nph       VPTSMTTVGAIAGLGLATGTLNYPVIAGIISWWVVTPVIGFWIGGIIGRYIYPEVNRRVQ
2328|gene|hut       VSTSMTAVGAIAGLGLATQTLNWAVLGEIAVWWLIAPVVGFWLGSIVGRYIYPYLDQYFA
2480|gene|hbo       ASTSMTAVGAVAGYGLATDRLAVQLIMEIVSWWLVAPILGFWLSAVVGRYVYDDIASVVA
12527|gene|hma      ASTSMTAVGAIAGLGLARGTLNAALMLEIVSWWLVSPIIAFWVSGVIGRYFYPTLVEWFA
2957|gene|hhi       ASTSMTAVGAIAGLGLARGTLNAALMLEIVSWWLVSPIIAFWVSGVIGRYFYPRLVEWFA
1034|gene|hut       ASTSMTAVGAIAGLGIASGTLDLTVVGEIVSWWIVSPVIGFWISAVIGRYFYTHLRRLIA
753|gene|nrc1       ASTSMTAVGAIAGLGLARDALDVAVMGEIVIWWVVAPVIGFWVSLIIGRYFYARLHRRVA
1653|gene|hla       ASTSMTAVGAIAGLGLATGTLDRAVMGEIAIWWIVAPIIGFWVSGVVGRYFYPAIDSWVA
1270|gene|nph       ASTSMTAVGSIAGLGLATGTLNWVTMGQIVSWWIVAPIIAFWISGVVGRYFYPTINEWVA
3455|gene|hwa       ASTSMTAVGAIAGLGVASGTLNEAVMLEIVSWWIVAPVLAFWICAVVGRYLYPYLDARLK
2490|gene|hbo       ASTSMTAVGAIAGLGVATGTLNEAVMLEIISWWIVAPVIAFWVCAVIGRYVYPYLDAKLE
2052|gene|hwa       ASTSMTAVGAIIGLGLATSTLNQALMFVILSAWIVSPLVCLTIGVVIGRYMYPYVDRYVA
5106|gene|hhi       ASTSMTAVGAIVGLGLATGSLNEALMFTIVSAWIVAPLIGLVIGAAIGRYAYPQLEARLS
                    .    .:.  . .            :  :    :.   : : :    *   :        

1922|hp|hhi         FQTKAAAMAFVTFHGLLGVIML--------MGVMFHIFEHGMHPAFYPVETKAFIPRSMV
6196|gene|nrc1      FESDD--------TG---------------RFAELVVIGIGCYMGFSTGASN--VASAVA
4804|gene|nph       IKKSEGPLLTLDRDAAVPKPTFGPNTTWTELISTSAVLVIGCYMAFSAGASN--VPNAAA
2328|gene|hut       LEQSEGPLVTVERSGLVPMPRLGPGTTTREFVSTIVVLLIACYMAFSAGASN--VANAVA
2480|gene|hbo       IDRSDGPLVILRRDGVVPVPALGAGTTPRELTGSLLVVAIGCFMAFSAGASN--VANAVA
12527|gene|hma      VSQSEGALLDFDRSGSIPRPGLGENTTQREFVGTVVVIGIGCYMGFSAGASN--VANAVA
2957|gene|hhi       VSQSEGSLLDFDRSGSIPRPSLGENTTPREFVGTVVVIGIGCYMAFSAGASN--VANAVA
1034|gene|hut       IDQSEGPLLTLDREGGLPRPAPGPNTSRREIVGTVVLVAIGCLMAFSSGTSN--IANAIA
753|gene|nrc1       MNRTEGALLRVDRTGAIPTVRPAENTNRRELFGVVTVITIGCLMAFSSGTSN--IANAIA
1653|gene|hla       IESTEGSLFVFDRSGIIPKPVPGPNTTRREFVGGFVVIAIGCLMAFSSGTSN--IANAIA
1270|gene|nph       IPDSEGN------------PLRGEG-SRRERVGALVVIGIGCLMAFSSGASN--VANAIA
3455|gene|hwa       LNRSPGPLITLDRSGSIPWIRRGPNTSNRELGSVCLVIIIACYMAYSAGASN--AANAVA
2490|gene|hbo       LDSSPGPLVEFDNAGILPKLRLGPNTTPREAWSTVLVIAIACYMAYSAGASN--AANAVA
2052|gene|hwa       FTTFDLHFIQLDRSNTIPRLIINPNASLQDIIGSFLVVIIGCYMAFSAGASN--AANAVA
5106|gene|hhi       FTRLERQLVQIDRSGRFPRLRLNRNASPRDLIGSALVLAIACYMGFSAGASN--AANAVA
                    .                                   :.  .   .: .  ::   . : .

1922|hp|hhi         PEH--HGDDDEEPD------TTGIERLSLSPSWRTVSTVFGAMTVIGIVSVLIGSIFDEG
6196|gene|nrc1      PLVG-SRQLEMTSGVAIGGVAIGVGAFAIGP--RTMETVGEDITDLSL------------
4804|gene|nph       PLVGGASGLPDDTAIILATIAIGVGGFTIAR--RTMESVGGELSDIPLLAALF-------
2328|gene|hut       PLVG-GGLLEPGPAVILGTATIGLGSFTIAR--RTMESVGNGITDLPLLAAMV-------
2480|gene|hbo       PLVG-NGSLSMNAGILLAGGAIAIGALTIAR--RTLETMGNELTELPLTAALV-------
12527|gene|hma      PLVG-NGSLELYPAILLGGGAIGLGAFTIAR--RTMDTVGNDLTDLPLVAAIV-------
2957|gene|hhi       PLVG-NGSLDMYPAILLGGGAIGLGAFTIAR--RTMDTVGNDLTDLPLVAAIV-------
1034|gene|hut       PLVG-SNELKMNPAILLGCAAVAVGAFTIAR--RTMETLGNDITDLPLTAAIV-------
753|gene|nrc1       PLVG-SGVVGMNPAILLGCAAVGVGSFTIAR--RTLETMGSDITELPLTAAIV-------
1653|gene|hla       PLVA-LDNVEMTPMILLGSAAVAVGAFTIAR--RTLDTLGNDITDLPLTAAIV-------
1270|gene|nph       PLVG-SGELSMNLGIIIATVAVGIGAFTIAR--KTLDTMGNDLTELPLTAAIV-------
3455|gene|hwa       PLVG-NGSVSMNIGIILATGAIGFGAFTIAR--RTLDTVGNDLTELPILAALV-------
2490|gene|hbo       PLVG-NGALKLNEGILLGAGAIGLGAFTIAR--RTLDTVGNDLTELPILAALI-------
2052|gene|hwa       PLVGSSGSLTVNQGVILAVGAFGVGGLTIAR--RTLEMVGDDITELPILASLI-------
5106|gene|hhi       PLVG-NGAVSIDQGVLLAVAAISLGGFTIAR--RTLATVGDGITDLPILAALI-------
                    *                   : ..  :::.   .*:  :   :: : :            

1922|hp|hhi         YPVPRELAIGGGPSSILLTIGINLGMVVLGVGLVLSMYGNVLRIRWEQQLEAEREPSTAA
6196|gene|nrc1      ------------------------------------------------------------
4804|gene|nph       ------------VMVTASTITTVLSWFGIPISLVMSTVMTIVGIGWGRATRPVTVSDAVR
2328|gene|hut       ------------VMVIGATITTIASAMGIPISLALSTVMTIVGLGWGRATRPATATELAR
2480|gene|hbo       ------------VATVSATLVTVLSLLGIPASFVVIATMSTVGLGWGRETTR--------
12527|gene|hma      ------------VAAVASTIVTFLSALGIPASFVIIATMSIVGLGWGRATRTTSLSDTVQ
2957|gene|hhi       ------------VAAVASTIVTFLSALGIPASFVIIATMSIVGLGWGRATRTTSLSDTVQ
1034|gene|hut       ------------VAVVSSTIVIALSAAGVPASFVVIATVNIVGLGWGRATRVVKIEDAVV
753|gene|nrc1       ------------VASVSATLVIFLSAIGIPASFVVIATVSIVGLGWGRATRPVSVQSAVS
1653|gene|hla       ------------VACVSSGIVISLSAVGIPASFVIIATMSIVGLGWGRATRTVTVKQGIS
1270|gene|nph       ------------VAVISSTATAALAAIGIPASFVIIATMSIVGLGWGRATRTTRARDAVR
3455|gene|hwa       ------------VETVSASVIAILSILGIPASLAVSATMCIVGLGWGRATRTVTIGDAIG
2490|gene|hbo       ------------VETVSASLIAFLSYIGIPASLAVSATMCIVGLGWGRATRTVTLGEALG
2052|gene|hwa       ------------VSVIGGTVITILSSFGIPASLAVSTTSTIIGLGWGRASRVATLAELVT
5106|gene|hhi       ------------VSSVGATIITVLSYYGIPASLAVSTTCCIIGLGWGRASRAVTLTELAT
                                                                                

1922|hp|hhi         ------------------------------------------DGGE--PQTDGGQPKSD-
6196|gene|nrc1      ------------------------------------------------------EASPD-
4804|gene|nph       R---DTGDAEIVPGAITAKG----------------------MEGK--AASPIGEAEPD-
2328|gene|hut       ----GDIDTTPSVDALAA------------------------ETDE--EVPAIGEESGE-
2480|gene|hbo       ----ERSYPVADPATLAG------------------------PTRSGIETVAAGRDSADT
12527|gene|hma      ----GE-APVASVGALTTDADAADAPTV--------GGKKGTPKPA--ETEPIGEESRE-
2957|gene|hhi       ----GE-TPVASVGALTTDAEAADAPTV--------GGKKGTPKPA--ETEPIGEESRE-
1034|gene|hut       ----GDETPPVSVGALAAD---DDAPTV--------GKPELIEDEH--DPEPIGDEPAQ-
753|gene|nrc1       ----GDSDVAVSVGGLAAD-----------------------DPDE--AVPAIGEEQPE-
1653|gene|hla       ----GEKEPKVSVGALKAD-----------------------------ETGPIGEGDPS-
1270|gene|nph       ----GE-ETNVSVGALAADEAATVGDTG--------------PESE--QSPPIGEEDPG-
3455|gene|hwa       ----GE-KPEMSVNALTA------------------------ETDT--SVPDVGEESSQ-
2490|gene|hbo       ----GK-SPEMSVNALAA------------------------ETQE--EVPAMGQETET-
2052|gene|hwa       PSP-DRPDVAVSTGALATS-RAEDTPSGPTIGDVASGEESTEKLDEVPGVPDIGSEGPA-
5106|gene|hhi       PPSESKPGPNLSTGALAAPSTEEEKPAGPTVGELAAGESPTPETSP--SVPAIGEEDIE-
                                                                                

1922|hp|hhi         --DNEN-----------------------------------------
6196|gene|nrc1      --R--------------------------------------------
4804|gene|nph       --EVLDAGDLFNPRAVIKYISMWIIGPSISTLLAYGFFRILPGVA--
2328|gene|hut       --KLQETGDLFDPSVVVRFVAFWIIGPTVATAMSYATFVVLPIAGTV
2480|gene|hbo       SLDVDEPATLYRPVTTARVIFMQNIVPAVATVGAYSVFSYVELAAVM
12527|gene|hma      --DIPSASDLFEPGTTARVIFLQNVVPSIATLAAYLVFRFLPIA---
2957|gene|hhi       --DIPSASDLFEPGTTARVIFLQNIVPSIATLAAYLVFKFLPIA---
1034|gene|hut       --EPPAQSNLFDPSTTARVLLMQNLVPMLATIASFATFELLFVV---
753|gene|nrc1       --DIPSAGDLFDPGTTVRVIAMQNLVPIVGTVSAYLAFRFLPIWGF-
1653|gene|hla       --DIPSASDLFNPGTSARVVLMQNVVPLLSTVGALVTFTLLFQFVW-
1270|gene|nph       --DIPAASDLFDPKTTGRVILMQNVVPAIATLGAFLVFRFVPVV---
3455|gene|hwa       --EL-TNQTLFDPGTTGRVIFFWLLTPSVSAAASYALFSFMPL----
2490|gene|hbo       --DL-AGSDLFDPGTTGRVIFFWLLTPSLSALASYALFAMSPF----
2052|gene|hwa       --DI-DEDSLFNPAAAKRIVTMWLLTPSLAIIGSYPVFMFLL-----
5106|gene|hhi       --EL-TAENLFDPAATSRIVILWVLTPSLSVVGSYLLFALLL-----