HOG Organism Gene ID Name Annotation
aHOG2290 hwa HQ3628 ureG urease accessory protein
aHOG2290 nph NP2014 ureG urease accessory protein
aHOG2290 hma Hma_7126 ureG urease accessory protein UreG
MUSCLE (3.6) multiple sequence alignment


7126|gene|hma      MSLTHRDVATVGIGGPVGSGKTSLLTALVPELRDQGLDVGVIANDILTQEDADVLRERFA
3628|gene|hwa      --MGYRDVAKVGLGGPVGSGKTALVQQLVPRLDDAGYDLGVIANDIMTQEDAQRLQSSFA
2014|gene|nph      --MGHRDVATVGLGGPVGSGKTAMVKRLVPRLDAAGYNVGVIANDIMTQEDADRLRESFE
                     : :****.**:*********:::  *** *   * ::*******:*****: *.. * 

7126|gene|hma      GVVPEDLVAGVETGACPHTGIREDPSMNLQQIDSFLADHPELDLVLVESGGDNLAATFNP
3628|gene|hwa      GQIEKDLIAGVETGACPHTGIREDPSMNLDKIDEFSESHPELDVVLIESGGDNLAATFNP
2014|gene|nph      GILPPDLVEGVETGACPHTGIREDPSMNIAAIDEFTESYPDLDVVLLESGGDNLAATFNP
                   * :  **: *******************:  **.*  .:*:**:**:*************

7126|gene|hma      ELADYSLYVISVAEGEDIPRKRGPGVVDCDLLVVNKTDLAPHVGADLDVMEHDANEVR-D
3628|gene|hwa      ELADYFIFVISVAEGDDIPRKRGPGITQADLLVINKTDLAPHVDVSLEVLQEDAMEVRGD
2014|gene|nph      ELADYFIFVISVAEGDDIPRKRGPGVTQADLLVVNKTDLAPHVDADLEVMRRDAETVRGD
                   ***** ::*******:*********:.:.****:*********...*:*:  **  ** *

7126|gene|hma      GPVVFTNCKDETNIDTVLSHVRDGVLFA
3628|gene|hwa      NPTAFTNCKTGEGIDDIMDIIERSVLFA
2014|gene|nph      APTCFTDCKAEEGIDGVVDHIEEGVLFA
                    *. **:**   .** ::. :  .****