HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0229COG2766arCOG02892Putative Ser protein kinasekinase anchor protein

HOG Organism Gene ID Name Annotation
cHOG0229 nrc1 VNG0748 prkA kinase anchor protein
cHOG0229 hmu HMUK2232 Hmuk_2232 putative serine protein kinase, PrkA( EC:2.7.1.37,EC:2.7.11.1 )
cHOG0229 hma RRNAC1068 rad3a helicase
cHOG0229 hwa HQ3002A prkA serine protein kinase
cHOG0229 hla HLAC0031 Hlac_31 putative serine protein kinase, PrkA
cHOG0229 hbo HBOR13590 Hbor_13590 putative Ser protein kinase( EC:2.7.1.37,EC:2.7.11.1 )
cHOG0229 hut HUTA0411 Huta_0411 putative serine protein kinase, PrkA
cHOG0229 hvo HVO_2848 HVO_2848 prkA kinase anchor protein
cHOG0229 nph NP3446A prkA_2 serine protein kinase 2
cHOG0229 hhi 1677 prkA2 putative serine protein kinase, PrkA/kinase anchor protein
MUSCLE (3.6) multiple sequence alignment


10680|gene|hma      -----------------MGDPASTGTESWRTYFGFDEPYENQADAV-ERAIEAGKARGFL
31|gene|hla         ---------MTERDTPDGDAFVRDADETLRGAYDPPMSLEEYVDRVLENPTAAASGARYL
748|gene|nrc1       ------------------------------------MSLAEYVDRAFEQPLAAAHASRYL
411|chp|hut         MSPERTDRGGTDRAGRDADSYVAAADRQLAETYEPPMSLESYVETILEEPHLAAGASTYL
3002|gene|hwa       ---------------MRMNNYITDADDRLQGTYEKPMTLGEYVDAAFERPSIASHASKYL
13590|hp|hbo        --------------MTPTRDYIREADEQLRGTYEEPMSLAEYVDAAFESPSIASHASKYL
3446|gene|nph       ---------------MTDGDYIGRADDALRDTYEPPMSLTEYVETVFENPTSAAHASKYL
1677|gene|hhi       ---------------MTGEEYIDRADESLDAAYEAPMSLAEYVDTVLETPQVAAHASKYL
                                                         .  . .:   * .  *. .  :*

10680|gene|hma      AMEGPCGTGKTMAALTAGATLVR----DTDLYERMVVVTPVKQQLQQFVDDLRALNAGID
31|gene|hla         L--AAVESQGTREVRERGERLERYRFFDDPFNDGEHAVLGNTAALNAFVDDLRAAAAGRG
748|gene|nrc1       L--AAIESAGTREVVENGERAQRYRFFDDPHNDGEHAVLGNTATLNAFVDDVRAIAAGRG
411|chp|hut         L--DAIEAAGTRTVVEEGEERERYRFFDDPHNDGEHAILGNTDVLNGLVEDLRTIAARRG
3002|gene|hwa       V--EAIESMGTRTVFEEGETRDRYRFFDDPANDGEHAVLGNTKVLNRFVDDLRTIAAERG
13590|hp|hbo        L--QAIEAAGTRTVIEEGEEKERYRFFDDPANDGEHAVLGNTEVLNRFVDDLRTIAAKRG
3446|gene|nph       L--KAIEAAGTRTVIEEGEEKQRYRFFDDPYNDGEHAVLGNTAVLNAFVDDLRSIAARRG
1677|gene|hhi       L--DAIEDAGTRMVIEEGEEKERYRFFDDPYNDGEHAILGNTEVLNAFVDDLRSIAAGRG
                        .     *  .   *    *    *    :   .:   .  *: :*:*:*:  *  .

10680|gene|hma      EP-----FDGISLVGKRDL--CPYGRESQFPDDVGTHDRCEDLREATARLVEDDGRSD-G
31|gene|hla         NDETIVWIDGPTATGKSEFKRCLVNGLREFSKTEAGRRYTVEWNVTGAGTGSGVGAGAAS
748|gene|nrc1       KAETILWFAGPTATGKSELKRCLINGLREFSKTDAGRRYTIEWNVSDA------DRGP-G
411|chp|hut         KAEKIIWLAGPTATGKSELKRCLINGLRAYSRTEEGRRYTVEWNASGA------DSTGSG
3002|gene|hwa       KSEKILWFDGPTATGKSELKRCLIDGLRAYSKTDEGRRYTVEWNVAAA------TDTR-G
13590|hp|hbo        KGEKIIWFDGPTATGKSELKRCLINGLREYSKTLEGRRYTVEWNVTNV------DDSR-G
3446|gene|nph       KEEKILWLDGPTATGKSELKRCLINGLREFSKTDNGRRYTVEWNVSAT------DATP-G
1677|gene|hhi       KDEKIIWLEGPTATGKSELKRCLINGLREYSKTPEGRRYTVEWNVAGA------GGNATS
                    :      : * : .** ::  *  .    :.     .    : . : .           .

10680|gene|hma      AAVADAAIAGEADDDQWWD-PRKGQDLAAAARPDAVEQSTLGD--------DTLQTAGAA
31|gene|hla         LSYGDG----GDAAA-WYRSPVQTHPLSVF--PEAVRESIADAVDD---DAYPIAADVDL
748|gene|nrc1       LTYGEEPV--DREDD-WYESPVQASPLSVF--PTDVREDVLADVNDHREDADALRADADL
411|chp|hut         LTYGDVPE--SDEED-WLESPVQTHPLAAF--PREVRADLVADLNDRLGDHPDVTVETDL
3002|gene|hwa       LSYGDETTTAERDDD-WYESPVQAHPLSTF--PRSVRRELLMELNDRAEDHIPIAVDEEL
13590|hp|hbo        LSYGGEVSGAEHESD-WYESPVQSHPLSVF--PAEVRRSLLAELNENEDGHIPVSLDEEL
3446|gene|nph       LTYGDDSS--PDEDE-WYPSPVQAHPLSVF--PERVREQLIADLNDSRTDHIPIALDAEL
1677|gene|hhi       MTYGNAAV--EDEDD-WYESPVQAHPLTVF--PDDVRTDLLAEVNERLDDHIPIRVDGEL
                     : .            *   * :   *:.   *  *  .              :      

10680|gene|hma      SPY-RQAQPTAPESMAEGSDPPLYCPFEADWYARNKGSPVDFSAGDEHVVTMDDYLPAAT
31|gene|hla         DPFSREAYDHLESVYRDEGRRDLFSAITDRDHLRVTSYVVDVGEGVGVLHAEDDGSPKER
748|gene|nrc1       PPFSREAYDHLEQQYRREGVADVFAAATDPKHLRVKNYVVERGQGIGVLHSEDAGSPKER
411|chp|hut         DPFSREAYEYLEEQYRRDGVDGLFSAVTDPRHLRVKNYVVDVGQGIGVLHAEDEGTPKER
3002|gene|hwa       DPFSREAYEYLEETYRRDGIEELFSAIIDPDHLRIKNYVVDVGQGVGVLHSEDDGSPKER
13590|hp|hbo        DPFCREAYDYLEEKYRRTGKRNLFTAVSDPKHLRVKNYVVDVGQGIGVLHSEDDGSPKER
3446|gene|nph       DPFSREAYDHLEERYRREGVEDLFSAVTDEKHLRVKNFVVDVGQGIGVLHSEDAGSPKER
1677|gene|hhi       DPFSREAYDFLEEQYRRQGETDLFSAVTQPAHLRVKNFVVDVGHGIGILHSEDEGTPKER
                     *: *:*     .     .   :: .     : * ..  *: . *   : : *   *   

10680|gene|hma      ERGTCPHRVMSVMLNEADVIVGNYNHLFDPGSRPLLSDVLDNQTLVIVDEAHRLEERVRD
31|gene|hla         LVGS----WMGGMLRELDSRGRKNPQAFSYDG--VLSQ--GNGVATIVEDASQHADLLRR
748|gene|nrc1       LVGS----WVAGLLGQLDSKGRKNPQAFSYDG--VLSQ--GNGCLTIMEDASQHADLLQK
411|chp|hut         LVGS----WMGGMLRELNSRGRKNPQAFSYDG--VLSQ--GNGVLTVVEDAAQHADLLRK
3002|gene|hwa       LVGS----WMPSMLQELDSRGRKNPQAFSYDG--VLSQ--GNGLLTIVEDAAQHADLLQK
13590|hp|hbo        LVGS----WMPSMLRELDSRGRKNPQAFSYDG--VLSQ--GNGLLTIVEDATQHADLLQR
3446|gene|nph       LVGS----WMAGMLQRLDSRGRKNPQAFSYDG--VLSQ--GNGLLTIVEDAAQHADLLQK
1677|gene|hhi       LVGS----WMHGMLRELDSRGRKNPQAFSYDG--VLSQ--GNGLLTVVEDAAQHADLLQK
                      *:     :  :*   :    :  : *. ..  :**:  .*   .::::* .  : :. 

10680|gene|hma      LLS---DRLGRQSIVQARNDCTTLIQRAQQSADHKAQVREVLSAREVPLDAVDQARKFYD
31|gene|hla         LLNVPDERRVKLDKGIGMDLDTQLIVISNPDLDAELDRHAEREGAD-PLKALK--RRLTR
748|gene|nrc1       LLNVPDERRVKLDKGIGMDLDTQLVVISNLDLEAQLNKHDDRQGFD-PLKALK--RRLSK
411|chp|hut         LLNVPDERSVKLDRGIEMDVDTQLLIISNPDLEAQLDQHAERGGSD-PLKALK--RRLDK
3002|gene|hwa       LLNVPDEGHVKLDKGIGMDIDTQLLIISNPDLDAELDKYADRNGQD-PLKALK--RRLDR
13590|hp|hbo        LLNVPDEGHVKLDKGIGMDIDTQLLIISNPDLDAELDKYSDRNGRD-PLKALK--RRLDK
3446|gene|nph       LLNVPDERRVKLDKAVGMDIDTQMVVISNPDLEAQLNKHAEMEGTD-PLKALK--RRLDK
1677|gene|hhi       LLNVPDESHVKLDKGIGMDVDTQLIIISNPDLEAQLNKHADREGQD-PLKALK--RRLDK
                    **.   :   . .     :  * ::  :: . : : :      . : **.*:.  *.:  

10680|gene|hma      DLVRWLDNR------IESFLDAEHEGWRA---------------DPSSLPEHDRE---IP
31|gene|hla         HEFRYLTNRRLEAELLRREVGGPRGVPTVDGIEDDEPIDTGENPARDPASEPSAASLTIG
748|gene|nrc1       HELGYLTSISLEAQLLRRELTGDAGVWTAT--------------DPEVLAERAAQPVTVS
411|chp|hut         HRFAYLTTLSLEAELLHRELTGETAVWTAG--------------TYDELAERIREPVHVE
3002|gene|hwa       HEFRYLTNVALEAELIRRELTDETAVWNAS--------------DESDLRERIRAPLTLE
13590|hp|hbo        HEFRYLTNVSLETELIRRELTNETDVWDVE--------------DREELEERINESLFVD
3446|gene|nph       HEFQYLTNLSLEAELLRRELTNETERWTAE--------------SYDELESRIREPVTLS
1677|gene|hhi       HEFTYLTNLSLEAQLLRRELTNETQVWDPE--------------TWDELETWIQEPLTIS
                      . :* .       :   :                          .           : 

10680|gene|hma      LRDPDTVEQDELTEWAERKGYEGSLWRSLSKVGAAVEDAIDQLGLTRQPVCAAVGVLAGQ
31|gene|hla         VRDGDKGITER--ELAPHAVGAAALYAVVTRLDT--DDLPAGIDLVEKAELYENGEIRRE
748|gene|nrc1       VRDDDGE-TER--ELAPHTIEAAALYSVVTRLDD--DDHGDELSLVEKALLFDRGYVG--
411|chp|hut         VREAEGT-TAV--ELAPHTIEGAALYDVVSRLSK--TDLPDALDLVDKALLFDQGYLE--
3002|gene|hwa       VRRGPGEITDR--ELAPHTVEAAATYSVVTRLEP--DDLPRGYDLVDKALLYEFGHLQ--
13590|hp|hbo        VRSGPGAVKRR--ELAPHAIEAAAMYSVVSRLDG--DDVPDGYSLVDKALLFDRGYLQ--
3446|gene|nph       VRDAEGTVKDR--ELAPHAVEAAALYAVASRLDA--ESLPPGIDLVDKALVYDKGYLQ--
1677|gene|hhi       VRDEVESATDK--ELAPHTVESAALYAVVSRLDS--AEIPTGLDLVDKALLFDRGYLM--
                    :*           * * .    .: :   :.:     .     .*. :.     * :   

10680|gene|hma      WWERDHATFLREIELEHSPNHGQTLDADYQAVYTPGLLCYNCMPATALRNVFDDLGGGIL
31|gene|hla         RSGEEQRITVDDIEFGDGD--GRN---GIPVTYVRDIVA-ELLGSDADRSHPELPVERVI
748|gene|nrc1       --SGEDRRDASEFDLADGAD-GAN---GIPVTYTRDVLA-DRLHADADRSHPDLAVERVI
411|chp|hut         --EGNERVDADEFDFEDHAGDGER---GIPVTFTRDVIA-DLLYADRERHHPDLDVESVL
3002|gene|hwa       --EGDTRTKIDEFDFTADDE-GSH---GIPVTYTRDIIA-DLLHETTDRHHPELDVGDVV
13590|hp|hbo        --VGDTREEIDEFGFDSDNE-GTH---GVPVTFTRDIIA-DLLHEDRDRHHPSLEVGTVV
3446|gene|nph       --DGDERRYREEFDFGDATE-GKT---GIPVTYTRDIVA-DLLHETPDRHHPDLDVETIV
1677|gene|hhi       --EGDERVDIDDYDLETTAEDGDH---GIPVTYVRDIIA-DLLHEPQDRHHPDLPVEHVL
                        :      :  :      *     .  ..:. .::. : :     *   .     ::

10680|gene|hma      MSATLEPLDVFTR-VSGLDSMAETGSTAPDEQSGDGRPVRSTTYDLPFPPENRASYLVDA
31|gene|hla         T-----PTDVLDAMAEALSDAPVFSRTEVAEFESRKAPVAERVRE------RQRADVVDA
748|gene|nrc1       T-----PGDVLSGMVDGLSSAPVFSDAERAEFNDRVAVVEAYIHD------QQAEDVRDA
411|chp|hut         M-----PRDVLAAMAEGLSEAPVFGESEVETFEERVNQVRTHIST------RQEADVLGA
3002|gene|hwa       M-----PTDVLDSMVEGLREAPVFSRSERTEYEERISTVRDHVRS------EQETDVLEA
13590|hp|hbo        M-----PDDLLDSMAEGLHDAPVFSRAERSEYESRVTVVKEYIFD------QQEADVLAA
3446|gene|nph       M-----PRDVLNTMAEGLDDAPVFSSAERTEYENRLVPVKNHIFG------RQESDVIDA
1677|gene|hhi       M-----PRDVLNAVAEGLVDAPVFSTGEATEYEERVVTVKNYIFG------QQEQDVLDA
                          * *::   ...* . .  .       .     *             .   :  *

10680|gene|hma      TPFTARNRGDPGTMRPLGDN---WNPTRDEYAQALRALARSPGNVMVAMPNYREARWAGA
31|gene|hla         --ILAEETVPEATVAEYVEHVYAWDA--EVPVETERGP-EEPDALAMKV---FETETLGR
748|gene|nrc1       --VLAGEGASESAVEEYVDNVHAWAT--GDTVENARGEQAEPDALSMKL---FETETLGR
411|chp|hut         --MLKEKRVERETVAEYVEAVYAWAT--DGRVENDRGEEVPPDPLTMRV---FEVEHLGR
3002|gene|hwa       --VLSEHSVERETVESYVEHVYAWND--DGRVETDRGP-VDPDPLLMKL---FETEQLGR
13590|hp|hbo        --VLADKHVEQETVAEYVEHVYAWES--DGQIETEHGP-VEPDALLMKL---FETEHLGR
3446|gene|nph       --IMREKQVDESTVEEYIEHVYAWVE--DETIENDRGESVPPDPLKMKV---FETEHLGR
1677|gene|hhi       --MMRDKRVDEATVEEYIEQVYAWES--DDQIENERGELVDPDPLKMKV---FEIEHLGR
                      .         ::    :    *        :  ..    *. : : :    *    * 

10680|gene|hma      YLQDAVEKPVLVDESSSNEETERLKREFFSGDGKVMVTSTRGTLTEGVDYDGEKLSTCAV
31|gene|hla         FD-ESD-----YRGTDPTEPVGTFRRE------RVIRALTRYAWRNRG--NAFSVGDADL
748|gene|nrc1       FDADTH-----YHGNDPTPAVETFRED------TVMTAVTRHAWEHRD--DEFHAHDVDL
411|chp|hut         FD-ESH-----YDGDEPGEAVRAFRND------KIVTAINRHAWESRD--EGFAVEEFDP
3002|gene|hwa       FD-ESD-----YTGTTPTNVVESFRRE------KIITALNRYAWENRD--AGFQIGNVDL
13590|hp|hbo        FA-ESD-----YTGNEPSADVKEFRRE------KVITALNRYAWENRD--EGFTVEDVEL
3446|gene|nph       FD-EDD-----YDGTEPEAAVETFRAE------KIITALNRHAWRNRD--AEFRVSDVDP
1677|gene|hhi       FD-EKN-----YDGNEPDHAVEQFRTD------KIITALNRHAWQRRD--EEFRVGDVNP
                    :  :            .   .  :. :       :: : .* :                 

10680|gene|hma      VGIPLVN--IGSPRVRGVQRAYGDAFGEDNAFEYALTVPAVRRARQAIGRVIRGVDEVGV
31|gene|hla         GEIPELKAVLESNDLADVKRRFPD-LDPAE------------WADPPADTETERTKATTI
748|gene|nrc1       STVPVLRDVLAGNDWDDVKRVHPE-FDPTQ------------WADPPEGTDTAAVKADAI
411|chp|hut         ESIPVIESILGSHDWEAVRRTFED-FDPHQ------------WADPPAGTETERVKERTI
3002|gene|hwa       SEIPVIRAVLDRYDWDDVKRLYED-FNPAQ------------WEDPPANTETARVKDRTI
13590|hp|hbo        SEIPVIRTVLETHEWDDVSRLFED-FDPDQ------------WDDPPANTETERVKERTI
3446|gene|nph       RDIPVIETVLGRHDWDDVRRTYGD-LDPAQ------------WDDPPSGTETERVKERAL
1677|gene|hhi       KEIPVINTVLGSYDWDDIQRTYAD-FEPGQ------------WDNPPSGTETARLKDKTL
                      :* :   :       : * . : :   :            .   . .      .   :

10680|gene|hma      RALVGR-RYTPDARHSVSPYLPAGEREEFTRMTPDFLASQLDSF----------------
31|gene|hla         ARLVDR-GYSPASAELTSRAVMRNVRDEWTSLTADGNTASEATPDRPIEDRSGRNGGGRT
748|gene|nrc1       SFLVSERGYSRASAELASRSVISEVTDE--------------------------------
411|chp|hut         DVLVGDYGYSPASAELTSRYVLEEVAHR--------------------------------
3002|gene|hwa       DVLCQR-GYTPASAELTSRAVMREVRQR--------------------------------
13590|hp|hbo        DHMVKN-GYTPASAELTSRAVMNEVRHE--------------------------------
3446|gene|nph       TNMQELFGYSPAAAELTSRHVMGQVSYR--------------------------------
1677|gene|hhi       DNMVEMFDYTPASAELTSRHVMSQVSYR--------------------------------
                      :     *:  :   .*  :                                       

10680|gene|hma      WADHRAD
31|gene|hla         W-----D
748|gene|nrc1       W-----D
411|chp|hut         W-----D
3002|gene|hwa       W-----D
13590|hp|hbo        W-----D
3446|gene|nph       W-----D
1677|gene|hhi       W-----D
                    *     *