HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0228COG1441arCOG01168O-succinylbenzoate synthasechloromuconate cycloisomerase

HOG Organism Gene ID Name Annotation
cHOG0228 nrc1 VNG1074 ykfB2 chloromuconate cycloisomerase
cHOG0228 hmu HMUK2249 Hmuk_2249 Mandelate racemase/muconate lactonizing protein
cHOG0228 hma RRNAC0844 ykfB1 chloromuconate cycloisomerase
cHOG0228 hwa HQ1876A menC O-succinylbenzoate-CoA synthase (OSB synthase; 4-(2'-carboxyphenyl)-4-oxybutyric acid synthase)
cHOG0228 hla HLAC1174 Hlac_1174 Mandelate racemase/muconate lactonizing protein
cHOG0228 hbo HBOR17700 Hbor_17700 enolase superfamily enzyme related to L-alanine- DL-glutamate epimerase
cHOG0228 hut HUTA0393 Huta_0393 Mandelate racemase/muconate lactonizing protein
cHOG0228 hvo HVO_1461 HVO_1461 chloromuconate cycloisomerase
cHOG0228 nph NP2736A menC O-succinylbenzoate-CoA synthase (OSB synthase; 4-(2'-carboxyphenyl)-4-oxybutyric acid synthase)
cHOG0228 hhi 1484 ykfB3 chloromuconate cycloisomerase
MUSCLE (3.6) multiple sequence alignment


1876|gene|hwa       MNELDCLETASIKIDPFTLELSRSLSTAVGDIEQRRGHVVCVD--INGT----VGIGEAT
1074|gene|nrc1      -----------M-----------------------------------------AALRAAD
393|gene|hut        -----------MEVDPVSLPLASPLSTATGTIERREGFLVRLE--DS------PGIGEAM
2736|gene|nph       -----------MDIQPFSLPLSSPLSTADGTIESRRGFLVRTE--IDGV----AGVGEAA
10844|gene|hma      -----------MKVDSFSLPLSSPLATARETISQRSGFVVRYD--HRGE----TGVGEAT
1484|gene|hhi       -----------MKVDPFSLPLSSPLATARETISQRSGFVVRYD--HRGE----TGVGEAT
17700|gene|hbo      -----------MRFDPFSLSLTRPLGTANGPIESREGFLVRVSANDDGEQV--TGLGEAT
1174|gene|hla       -----------MRLRPFSLALASPLETARGSIDRREGFLVAVDPGADGESVPAPGLGEAT
                               :                                          .:  * 

1876|gene|hwa       PLPGWTERYPDCQDALRSVSTDSTSTSTSTSTSTSASEITPDTR-SAAHHGIELACVDAM
1074|gene|nrc1      DADSWERALDACMDA------------------------------PAARHAVSLARMDAD
393|gene|hut        PLPGWTESLEGCREVLETTKSVVRKRG-LDA---ALDELDPSET-PAARHGLDLAIADRH
2736|gene|nph       PLPGWTESYDACQAALCGVEKPKQ----------ALEDNVFDDT-PAARHAVSLAVADAA
10844|gene|hma      PLPGWTESLDDCQRGLNDAATVAAGGG-HTD---VLLSLDAASV-PAARHGFATALLDAD
1484|gene|hhi       PLPGWTESVDDCQRGLNDAATVAIDGG-HTD---ILLSLDAASV-PAARHGFATALLDAD
17700|gene|hbo      PLPGWTESLADCRA--------------------ALERGDPDATTPAARHGYSLARADAE
1174|gene|hla       PLPGWTESRSACEAALRGAEDENDGKALATD---ALDRLDPTET-PAARHGLALALADAT
                       .*      *                                 .**.*.   *  *  

1876|gene|hwa       ARHHDSSLARFLST----DTPATSIPVNATIGDCDSEQTYKKAESAVEDGYTTIKLKVGA
1074|gene|nrc1      SCAAGRPLASALSD----GAAADSVPVNATVGDGTAAATSAAVADAAADGFDTVKVKVGS
393|gene|hut        AREAGQSLAASLDP-----SPSQSVPVNATVGDASPEETAERASAAIDAGFETVKLKVGA
2736|gene|nph       ARRAGVPLYRRLGA----GERVESVPVNATVGDGSPSATAEAVADAAAAGFPAAKVKVGN
10844|gene|hma      ARADGVPLYQWFDS----ERHCNRVPVNATVGDGSPAETADAVERAVEAGYDCCKLKVGK
1484|gene|hhi       ARADGVPLYQWFEP----DRRCDRVPVNATVGDGSPAETADAVEQAVEAGYDCCKLKVGK
17700|gene|hbo      ARETDVRLCARLAAEHGVGPSADAVPVNATVGDDTPTETADAVREMVESGFDVVKIKVGA
1174|gene|hla       ARDAGQSLAERLAENENLPAPTETVPVNATIGDVDSEDTVAAAENAVEKGFDCLKVKVGA
                    :   .  *   :            :*****:**  .  *   .      *:   *:*** 

1876|gene|hwa       RDIESDCNRVIAARSAVGEDITLRVDANGAWNRTAAERFLETARTVDIAYIEQPLPASDL
1074|gene|nrc1      RSVRADLDRLRAASDTAPAGLSLRADANGAWDLDAARQAADACGSLPIEYIEQPLAPTRL
393|gene|hut        RSIGEDVSRVRAVRDAIGPQPEVRVDANAAWTVADARRAIDGLVPLDVSYIEQPLAADDL
2736|gene|nph       RSLDADIERIEAVRQR-YPDIELRVDANGAWEFETAREAVESLSALGVAVLEQPLPAEAL
10844|gene|hma      RTVDEDVARVRTVRERVGDDVTLRADANGAWSRDRAQEAFDRLAPLDVAYVEQPLPADDL
1484|gene|hhi       HTVDEDVARVRAVRERVGDDVTLRADANGAWSRKEAANAFDRLAPLDVAYVEQPLPADDL
17700|gene|hbo      REPEADRARLRAARDA-APDAELRADANGAWGRETAAEMLDAAAELDYAYVEQPLPADDL
1174|gene|hla       RGLDADIERLRAVRRAVGGDVSLRADANGAWDRETAREAVERLAPLDLAYLEQPLPADDL
                    .    *  *: :.         :*.***.**    *    :    :    :****..  *

1876|gene|hwa       DGHALLR--GRGVD----------IAVDESMNRTSPEQIFAADAADIIVCKPMALGGPKQ
1074|gene|nrc1      DATRSIG----GVP----------IALDEALHQHPLDAALA--VADYVVLKPMVLGGIDR
393|gene|hut        DGHAALR--DRGVE----------IALDESLRDVGLDAILDAGAADVLVLKPMAVGGIRR
2736|gene|nph       DNHRRLR--GHGID----------IALDEGLLRHGVDAAIAAEAADCLVCKPMALGGVDI
10844|gene|hma      TGHAGLR--GNGVG----------VALDESLVDRRVDSVLDADAADVLILKPMVLGGPGN
1484|gene|hhi       TGHAELR--GSGVG----------VALDESLVDRRVDSVLDADAADVLILKPMVLGGPGN
17700|gene|hbo      TGLAELR--GCGVG----------VAVDETLASHAVAAVLDADAADVLVLKPMALGGPDR
1174|gene|hla       DGAAALRTVGSGVDTDTDRDPPVPIALDESLATRGLDAVLDADAADAVVLKPMALGGPDR
                         :     *:           :*:** :        :   .** :: ***.:**   

1876|gene|hwa       TLAVARKAEAVDIDTVVTTTIDGVIARMGAVHIAAALPGSGSNARACGLATGSMLADDLT
1074|gene|nrc1      ARDAARTARQAGVEPVVSTTIDGVVARTAAVHLAASIP----DVPACGLATADRLADALA
393|gene|hut        ARTLALEARQQHLDPVVTTTVDGVVGRTAALHLAASLR----IERACGLATADRLADDFA
2736|gene|nph       ARSAAERARADGWDVIVTTTIDGVVARAAAVHLAASVP----DVRPCGLATGGRLASDVG
10844|gene|hma      AHTLALRAREQGVEPVVTTTIDAVVARLAALHVAAAIP----DVAACGLATGDRLAADLA
1484|gene|hhi       AHTLALRAREQGVEPVVTTTIDAVVARLAALHVAAAIP----DVAACGLATGDRLAADLA
17700|gene|hbo      TLDAAQTARDAGVEAIVTTTIDGVVARLGALHVAAAIP----DVPACGLATGSLLADDLA
1174|gene|hla       ALAAARRAREAGVEPVVTTTIDAVVARTAAVHVAAAIP----DVSPCGLATGSLLDTDLA
                    :   *  *     : :*:**:*.*:.* .*:*:**::        .*****.. *   . 

1876|gene|hwa       ANPVSISDGEISVPTGPGLAGGALRSCC---NR
1074|gene|nrc1      PDPAPVAGGRIQVPADPGHGVEVTADA------
393|gene|hut        PDPAPVSEGRMVVPDALGIGVDPSLRR------
2736|gene|nph       PDAAPVSDGTAAVPQGKG-NIPPL---------
10844|gene|hma      PDPTTVTDGAMSVPQSTGLGIDPTEVGT---DA
1484|gene|hhi       PDPTTVTDGAMSVPQSTGLGIDPTEVGT---DA
17700|gene|hbo      PDPAPIREGAMSVPDGPGLAGDALQALSHPGDS
1174|gene|hla       PDPCPISDGAVTVPTDPGLAGDAFDDLL-----
                    .:. .:  *   **   *