HOG Organism Gene ID Name Annotation
aHOG2261 hbo HBOR06660 Hbor_06660 predicted metal-dependent phosphoesterase, PHP family
aHOG2261 hla HLAC2120 Hlac_2120 hypothetical protein
aHOG2261 hwa HQ3120 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2120|hp|hla      MRTITETLQPDV----SYRVRQRLGPLVTRFARRFGQPEYRLRDTEYVGTVQR-------
6660|hp|hbo      -MSLTVRIDPHVHSDASYDAHDPVELILEQ-AAEIGLDAVVITDHDVIHESVRAAELAPM
3120|hp|hwa      -MTLTVTIDPHVHSAASYDADDPAELLLEQ-AAEIGLDAIVVTDHDVLHESLRAADLAPR
                   ::*  ::* *    ** . :    :: . *  :*     : * : :    *       

2120|hp|hla      -------------------------------PLDEFTETLQEHG--------FEWDPLAW
6660|hp|hbo      YGLVGIPGVEVSTADGHLLALGVREMPPRRAPMKETIEWVRDRGGVAIIPHPFQRSRHGI
3120|hp|hwa      YGLIGIPGVEVSTADGHLLAIGVTSLPPRRAPMTKTVSWVRDRGGVAIVPHPFQRSRHGI
                                                *: :  . :.:.*        *:..  . 

2120|hp|hla      YHQPPVGSEPDGSWTYQRSLLADRQ-IHAILIAHSPDYVDVFAHEEYN-------WLRHP
6660|hp|hbo      RKKRLQGVEPDAIEVYNSWLFTGWKNRRARRFARSGGYPGVAGSDAHKVGYVGRAYTEID
3120|hp|hwa      RKRRLRQVDPDAIEVYNSWVFTGRKNRRARQYAEVNGYPGVAGSDAHKVGYVGRAYTEIE
                  :.     :**.  .*:  :::..:  .*   *   .* .* . : ::       :    

2120|hp|hla      IKHLRQVDIEREAGSDEMR---RWIESQGISIDIRSRR------RRRTSHAIRDCYK---
6660|hp|hbo      IPDVQRVGLTADVILDAIRDGATRVEGRRTPIPTSARHYAGAGLRKSGYFAKLGVRKSGS
3120|hp|hwa      IPEITRSTLTADVILDAIREGATQVEGRRTPISTSTRHYLNAGIHKSGFYAKRGALRGGA
                 *  : .  :  :.  * :*    .:*..  .*   :*.      ..   .*  .  .   

2120|hp|hla      --------------YLVSIVR
6660|hp|hbo      VAKTGVVQAARTLYRVSPFSR
3120|hp|hwa      LAKTGMIGAGRLLYYVSPFS-
                                : .: