HOG Organism Gene ID Name Annotation
aHOG2251 hbo HBOR22050 Hbor_22050 hypothetical protein
aHOG2251 hla HLAC2111 Hlac_2111 hypothetical protein
aHOG2251 hwa HQ1588 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1588|hp|hwa       MSDRKPENQDDTDDLAVLLDDLNTTLSALEEAVDDEQQSSSSRSSQTSRDRNSASRDSSV
22050|hp|hbo      MSERRDPD----DDLADLLADLDRTLGDLRHELRDRERGRGSRSESEDDRRERRRRGRGD
2111|hp|hla       MSSRDDRRD---DDLEERLDELEDVLSELRRDLRETERD---------------------
                  **.*        ***   * :*: .*. *   : : :..                     

1588|hp|hwa       QRRDGAQTDNRSEDDG-------------------GSSIGNVFRFTEEYTLPALISILET
22050|hp|hbo      RRRRDEPSEREADRYGYRRRDDSDRSRGRDRPLPRPPSFSEVLRFTEEYTIPTVISVLET
2111|hp|hla       --RRGPPR---------------------------PPRLSELVRFTEQYTIPTVIALLET
                    * .                               . :.::.****:**:*::*::***

1588|hp|hwa       TIESLELLRGVLRFVDPEQSAFRDRSQTQNRRRRGKSPRRDPVSTVGREALSGLDRALSE
22050|hp|hbo      TIRSLELLQSVLRLADPERSVFDADD------RRRSTAERLGMTRMGREALSGVDRALDD
2111|hp|hla       TIKSLELVQGTLRLADPGRSL--DET--------GAATDRLGDVRDGASA--GLSRSLSE
                  ** ****:...**:.** .*                :. *      * .*  *:.*:*.:

1588|hp|hwa       IEETLAADNDQSLPSDRIPRDLLADARDLSAEVADRLGDVQNRPDRRR--QRDTRELPRN
22050|hp|hbo      LGDALS--D---LPPDAESRDIVTDARDLMGEIEDRIEEAERQRERSRYGYREDRGESGD
2111|hp|hla       LRTALSEAD---LPEEAASRSIIGDARDLTAEIEARIDEGRREADAARRGRRD-------
                  :  :*:  :   ** :  .*.:: ***** .*:  *: :  .  :  *   *:       

1588|hp|hwa       RPDDTTRQERQRSQDSNNTAEQRQNEGAV----TIDVDAPRKTANNDDGENKSSTDTHSD
22050|hp|hbo      RTD-----ERSGGQDGRD-SGRRDRDSSRRDSATNAPVTIDVSDERGDGRTEDPEDE-TP
2111|hp|hla       RTD-----GRDETRTTNEVNGDRDDRGVRID--VTDPDADREGENDGNGEADDSDDDPAP
                  *.*      *.  .  .:    *:  .      .    :     : .:*  ... *  : 

1588|hp|hwa       VTMMDNNAASNSESVNVDVESELASIKDTVDPDERFIDTDA-------------------
22050|hp|hbo      ---------------QVDVDAELESIRKEVRGEGADDTEDA-------------------
2111|hp|hla       ---------------EVDVESELESIKRQIDDREADTAADAGDETVDTEGAAADAGGETT
                                 :***::** **.  :         **                   

1588|hp|hwa       DADNN------------TDSSDDDNSGDRQSE
22050|hp|hbo      DVDGE------------DEETSDDNTTDNN--
2111|hp|hla       DADHDSADNGSSAGNERDDEPADGDDDDRDSV
                  *.* :             :.. *.:  *.: