HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0225COG1587KOG4132Uroporphyrinogen-III synthaseuroporphyrin-III C-methyltransferase

HOG Organism Gene ID Name Annotation
cHOG0225 nrc1 VNG2332 cysG uroporphyrin-III C-methyltransferase
cHOG0225 hmu HMUK1103 Hmuk_1103 Uroporphyrinogen III synthase HEM4( EC:4.2.1.75 )
cHOG0225 hma RRNAC3088 hemD uroporphyrinogen-III synthase
cHOG0225 hwa HQ3452A hemD uroporphyrinogen-III synthase
cHOG0225 hla HLAC2254 Hlac_2254 Uroporphyrinogen III synthase HEM4
cHOG0225 hbo HBOR01450 Hbor_01450 uroporphyrinogen-III synthase( EC:4.2.1.75 )
cHOG0225 hut HUTA0928 Huta_0928 Uroporphyrinogen III synthase HEM4
cHOG0225 hvo HVO_0076 HVO_0076 hemD uroporphyrinogen-III synthase
cHOG0225 nph NP1330A hemD uroporphyrinogen-III synthase
cHOG0225 hhi 342 hemD uroporphyrinogen-III synthase
MUSCLE (3.6) multiple sequence alignment


3452|gene|hwa       --------------------MVTAVELLEEYGITPIPDPMLSVEPTGT------------
1330|gene|nph       ------MTSRVAFFRPDDERAVEAAVTVSELGAEPLSDPMLEVEPTGR------------
1450|gene|hbo       ----MSQQVRVAVFRPDDDRMSDAVELLDSLGATPIPDPMLAVEPTGA------------
928|gene|hut        ---MTDDRPTVAVFRPDDERLETAVELLESLDANPIADPMLAVEPTET------------
13088|gene|hma      --MREEPRLRVAAFRPDDDRLDDAVELIESLGADPVPDPMLAIEPATADDAEATGRQ--V
342|gene|hhi        --MREEPRLRVAAFRPADDRLDSAVELLESLGADPVPDPMLAVEPAAAGDTDGDGDDGPV
2254|gene|hla       MSDGNSNTPRVAVFRPADERIEDAKALLASLGADPVADPMLAVEPTDA------------
2332|gene|nrc1      ---------------------------------------MLAVDPTGA------------
                                                           ** ::*:              

3452|gene|hwa       IPEIDTVSDASPFVVLTSKTGVEILADAGWNPTVATLVCIGPRTAAAARDVGWTVDIIPT
1330|gene|nph       TPRDD-----AAYTILTSKTGAELVADTGWQPGGE-LVAIGTATAGALEAAGFDVDRLPE
1450|gene|hbo       MPD-S-----GDYVILTSKTGVELLAEDGWEPNGSTLACIGPATADAARDSGWSVDIVPE
928|gene|hut        LPRTD-----AEVVVFTSKTGAELVAGE-WTPGDATVCAIGEPTAAALRANGIAVDVVPE
13088|gene|hma      TPRSD-----ADYVVLTSKTGVELAAEAGWDAGEATVCAIGDSTAEALHEAGYGVDIIPA
342|gene|hhi        TPRTD-----ADYVVLTSKTGVELAAEAGWDPGEATVCAIGQSTAEALHEAGYGVDIIPA
2254|gene|hla       TPE-D-----APYVVLTSKTGVELAAEAGWEPGDATLVAIGPATAEAARAAGWTVDLVPD
2332|gene|nrc1      IPRGD-----GAVVVVTSKTGVELAADSGWTPGGGRLAAIGPATADACREAGWTVDVVPE
                     *  .     .  .:.*****.*: *   * .    : .**  ** *    *  ** :* 

3452|gene|hwa       EYSSQGLVDALADQVTDRSVIIARSDHGSETLIDGLDAAGAAVTETVLYKLVRPDGTGQS
1330|gene|nph       EFSSSGIVSELEADAPGTRIEVARSDHGSDVLTDGLVDAGGYVHETVLYRLVRPDGAGDS
1450|gene|hbo       EYTSSGLVERLRDDVANATVEVARSDHGSDVLTDGLREAGADLHETVLYRLVRPEGAGQS
928|gene|hut        TYSSSGLVDALGEQVDGLRVEVARSDHGSDVLLDGLESAGAYVHETVLYRLVRPANAGES
13088|gene|hma      EYSSTGLVETLSGAVAGARVEVARSDHGSAVLTDGLEAAGAYVHETVLYRLVRPEGSGES
342|gene|hhi        EYSSTGLVETLSGAVAGTRVEVARSDHGSAVLTDGLEAAGAYVHETVLYRLVRPAGSGES
2254|gene|hla       EYTSAGLVAALEDRVDGEHVEVARSDHGSDVLLAGLREAGATVTETVLYRLTRPSDAGES
2332|gene|nrc1      EYTSAGLVAALDGDIDGARVEVARSDHGSAVLTDGLAEAGAYVHETVLYALTRPAGAGDS
                     ::* *:*  *     .  : :******* .*  **  **. : ***** *.** .:*:*

3452|gene|hwa       TVMAAGNELDAVCFTSSLTVEHFLSAAANRELREETIMGLNNAVVGTIGEPTRETAQAHG
1330|gene|nph       AVAAADGDLAGACFTSPLTVEYFLEAAADRGCRDAALEGLNTAVVGAIGDPTREAAAEHG
1450|gene|hbo       TVMVAGDEVEGVCFSSSLTVENFLDAAAERGVREEVIEGLNSLVVGVIGPPTRETAESYG
928|gene|hut        VRRAAEGDLDAALFTSSLTVEHFLAIASERGQRAAAIEGLSEAVVGTIGGPTRETAAGQG
13088|gene|hma      AELAASGDLDAALFTSSLTVEHFLDAAADLGLREAVIDGLNEATVAAIGQPTRETAEDAG
342|gene|hhi        ADLAATGDLDAALFTSSLTVEHFLDAAAERGVREAAIDGLNEATVGAIGEPTRETAENAG
2254|gene|hla       AAMAAAGDLDAAAFTSSLTVTHFLDAAAERGVREAAIEGLNDAVVGVIGPPTAETAADSG
2332|gene|nrc1      TEIAAAGDLDAALFTSSLTVEHWLAAARERGIESAAREGLADATVGAIGPPTAETAADHG
                    .  .* .:: .. *:*.***  :*  * :      .  **   .*..** ** *:*   *

3452|gene|hwa       VRVDVTPADATFEHLVEAVVNELQTGQLSSDIDETDVADNKTESVESYDDRQV
1330|gene|nph       IEVDVVPGTAEFAALAEAVVDQL------------------------------
1450|gene|hbo       INVDVVPENADFEELACAVVETAAPTYHK------------------------
928|gene|hut        VDVDVVPEAAEFEALATAVIDRLDR----------------------------
13088|gene|hma      ISVDVVPDQADFEALACEAIEAAAPTHHE------------------------
342|gene|hhi        ISVDVVPDQADFEALACEAVEAAAPTHYE------------------------
2254|gene|hla       IDVDVVPDDADFEALARAVADAVVERSSAKR----------------------
2332|gene|nrc1      ISVDVVPDDAGFEALARATIEDA------------------------------
                    : ***.*  * *  *.  . :