HOG Organism Gene ID Name Annotation
aHOG2248 hbo HBOR31950 Hbor_31950 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component
aHOG2248 hbo HBOR32120 Hbor_32120 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component
aHOG2248 hla HLAC2148 Hlac_2148 binding-protein-dependent transport systems inner membrane component
aHOG2248 hwa HQ2631 ssuC sulfonate ABC transporter permease
MUSCLE (3.6) multiple sequence alignment


2148|gene|hla       MATDT-----------GREFDGDELR----SGLGLD---DPRRLLRGLAGVVGFVVVWHL
31950|gene|hbo      MSLRT--------------------RPAVESGLNVGRKADVNQSVLGAIGLTSFLAVWWL
32120|gene|hbo      MATEF-----------DRGGESDGSRASSARQMLFGGGFERKRISRGVLGTGCFLALWWL
2631|gene|hwa       MSVETPTDSEPAVPTGDRNQDRDEETGSVETTQGLFGDIDPASIGYGIVGSSIFVTIWQV
                    *:                                .    :      *  *   *:.:*.:

2148|gene|hla       ISLT-QAAYVLPSPVAVGDAFAEEFASGTMT---------------TALWSSIRHWIPGT
31950|gene|hbo      AAALVEPTYLLPGPLPVLSALVTEVTTTAPLSLPVTGGTVELPRAMTRLAQTSLHLVPGL
32120|gene|hbo      AGRT-QPSYLLPTPPEVGLALWTELTSGELF---------------VHLGQSLLHYVPGV
2631|gene|hwa       AAAAVDQTYLLPSPIEVATAFIIELTASATFTLPIAGITVPMTRLTANLAQSLLHYLPGL
                     .   : :*:** *  *  *:  *.::                   . * .:  * :** 

2148|gene|hla       VVGTGLGVAAGVAFSWSGLLDDVTAPLVRTLRPVPPLALIGFAIAWFGINHAGAAFIIAV
31950|gene|hbo      LAGAFVGNGAGLVIGYATRADAIATPVVRVLRPIPELAWIAFAIVWFGIGHTGATFIVAI
32120|gene|hbo      VVGVTVGSAVGIAVGWSDALDDACTPIIRILRPIPPLAWIVFAIIWFGLGHSGAAFIVFI
2631|gene|hwa       VVGSTLGVSLGLAMGWSGRLDNALTPVTRFLRPIPPLAWIVFAIVWIGIGHGGAAFIVGI
                    :.*  :* . *:...::   *   :*: * ***:* ** * *** *:*:.* **:**: :

2148|gene|hla       GAFWINFYASYGAVEGVSEDLLDVGRTLGVRGDLDMVRSIVLPASMPGITTGIRTGLGRC
31950|gene|hbo      GALWINYYAAYSGVRGVRDGYKEVAASLGIRTHVGMLRYVILPAASPAIVNGFRTSIGRC
32120|gene|hbo      GAFWITFYNAYSGVESASRELMEVAETLGVDTDWRLIRRVVLPDATPELLTGLRTSVGQC
2631|gene|hwa       GAFWINFYNAYAGVEGVSTHLKEVAASLGVDDDLTMIRKVIIPAAMPSITTGLRTSIGQC
                    **:**.:* :*..* ..     :*. :**:     ::* :::* : * : .*:**.:*.*

2148|gene|hla       WMLVVASEIFGVPGVGREILRASNNLLVDKVIAYILVLSLMFLLVDVAFRAVQRRVLVWR
31950|gene|hbo      LMIVVGAELFGAPGVGYEILNASNNLDMARSMAYMLLISAVYICVDGGYAALESRWFAWH
32120|gene|hbo      WMMVIAAELFGAPGVGYEIITSSNNLATERSVAYMLTISAVFLVSDWGVRRLEARLLAWR
2631|gene|hwa       WMIVVAAELFGAPGVGFQIINAAQNLATDVSVAYMVVISLVFLVSDGVFRRVERRLLEWR
                     *:*:.:*:**.**** :*: :::**     :**:: :* :::  *     :: * : *.

2148|gene|hla       A
31950|gene|hbo      P
32120|gene|hbo      Q
2631|gene|hwa       V