HOG Organism Gene ID Name Annotation
aHOG2232 hla HLAC0288 Hlac_288 DNA photolyase FAD-binding
aHOG2232 hwa HQ1298 phr deoxyribodipyrimidine photolyase
aHOG2232 nrc1 VNG1754 phr1 photolyase/cryptochrome
aHOG2232 hma Hma_10721 phr1 photolyase/cryptochrome
MUSCLE (3.6) multiple sequence alignment


288|gene|hla        --------MQLFWHRRDPRTRDNVGLAAAARTG--TVVPVFVYDTDLFGTMGARQRAFFL
1298|gene|hwa       --------MRLFWHRRDPRLRDNAGLAAAARADSESVLPVYVYDSDLFGAIGERQQAFWM
1754|gene|nrc1      --------MHLYWHQRDLRVPDNRGLHAATDGD--TVVPVYVFDDTVLSQVGRPKRAFLA
10721|gene|hma      MLVSLTKCMHVFWHQRDLRIPDNRGLTAAAADD--EVLPVYVLDTDLLANIGKRQKAFLL
                            *.::**.** *  ** ** **:  .   *:**:* *  ::. :*  :.**  

288|gene|hla        RHVKRLKERYREFGSDLVVRAGDPEKVLVDLADEYDAEAVFYNEYYRPARRNRQRAVEGA
1298|gene|hwa       HAVRELKEAYRERESDLIVRAGDPGDIIPALAEEYDIDGVHCNQHYRPGRQSRRERVASE
1754|gene|nrc1      AGVRALRAAYRERGSDLLVREGDAESVLPALADEFDADTVFHAAHYDAARRNRRTRVADA
10721|gene|hma      AGVRALKQAYRDHGGELLVKKGTAVDVLSNVVDEYDADRVYYNEHYRPARRNRQRRVDEA
                      *. *.  **:  .:*:*. * . .::  :.:*:* : *.   :* ..*..*.  *   

288|gene|hla        LEGFGVETNARTDAVLVDPGRLEERYANHGRFHDEWETVPKPEPSPEPDADALVNMRDEK
1298|gene|hwa       LDKSGIAFDVRTDHVLVDPGRLDASYPNHSQFHNDWEDVPKRSAYDSPPAETLVDITDSK
1754|gene|nrc1      LAAAGVDTAGHVDHTLVDPATLDDAYPSHSQFYDDWQQAPKPDPVPAPDADALADVHDDH
10721|gene|hma      LPTKSL-----TDLVLVDPAGLDSQYENHSRFYDDWQAHHKLPPVGSPDSGSLVDVSDPT
                    *   .:     .* .****. *:  * .*..*:::*:   *  .   * : :*.:: *  

288|gene|hla        TVSEIDPDIDPDIDLPATGYRAARERFDGFLEHGIRSYADTRDDLARAVEAPTHAVSRMS
1298|gene|hwa       TV----PVPTVEIDLPPSGYEAARDRLDRFCDRGIYDYNDTRDDLAQAAEKPTTAVSRMS
1754|gene|nrc1      TL----SVPAPEPPLPDAGHAAATDRLAAFLDDGIASYNDTRDDLAAAVDAPASAVSRLS
10721|gene|hma      TA----PTIETEMDLPTPGYEGARQRYDDFLTGGIETYNDTRDDMQAAVERPTSAVSRMS
                    *     .    :  ** .*: .* :*   *   **  * *****:  *.: *: ****:*

288|gene|hla        PYLATGAIGIREMWADATDAFEAATGDERRNVDKYRDELSWREQMYHLLYYTPDLAVANY
1298|gene|hwa       PYLSGGMIGIREVWDAASSVYEAVHGNERRNADKYRYELSWREQNYHLLYYNPDLAVSNY
1754|gene|nrc1      PYLAAGNIGVREVWAAVADAYDDATGNAARNIGKYRYELSWREQNYHLLYHTPRLQTENY
10721|gene|hma      PYLAAGMIGIREMWRDASDRHTEATGDAQRNIQKYRYELSWREQSYHLLYYNPTLLSENY
                    ***: * **:**:*  .:. .  . *:  **  *** ******* *****:.* *   **

288|gene|hla        KSFPNEIAWREDDTAFEAWTRGETGYPLVDAGMRQLNAEGYVHNRPRQVVASFLTKHLLI
1298|gene|hwa       KSIPNEIQWRDDDEAFKSWALGQTGYPLVDAGMRQLNREGYIHNRPRQVVASFLTKHLLV
1754|gene|nrc1      VSFDAPIAWQNSDDHFEAWTRGETGYPLVDAGMRQLRAEGYVHNRPRQVVASFLTKHLLV
10721|gene|hma      KTFPNRIEWENDEDNFEAWKHGETGYPFIDAGMRQLEQEGYIHNRPRQNVASFLTKHLLV
                     ::   * * :.:  *::*  *:****::*******  ***:****** **********:

288|gene|hla        DWRRGARYFTTQLIDHDHASNHGAWQWTASTGTDSVDVRIFDPVAQMAKYDADATFVKEY
1298|gene|hwa       DWRRGARYFTKQLIDHDYASNHGSWQWIASTGTDSVDVRIFDPVSQLSKYDDGANFVREY
1754|gene|nrc1      DWRRGERHFADRLVDYDPANNAANWQWTASTGTDTVAVRIFDPVSQMAKYDSDAAFVTEY
10721|gene|hma      DWREGARHFRKRLVDHDPANNAASWQWTASTGTDSVDVRIFDPVAQMSKYDSGADYVTEY
                    *** * *:*  .*:*:* *.* . *** ******:* *******:*::*** .* :* **

288|gene|hla        VPELRDVPAEEIVDWPTLSRVERETLAPEYPHPIVDRNEGYERAQRVFEEAL-GKR
1298|gene|hwa       VPELSDTPTEKIIEWPTLSPGDRAQFAPEYPDPIVGRNEGYERAQQTFEKAL-GKR
1754|gene|nrc1      VPELRGVDPETIVDWPTLRHSQRERLAPDYHHPIVDRDHAYERAQRVFEAALDGDA
10721|gene|hma      VPELRGVPSTKIVDWPTLSDGEREELAPDYYHPIVDRNAAYERAQRVFETAL-GKR
                    **** .. .  *::****   :*  :**:*  ***.*: .*****..** ** *.