HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0222COG0147KOG1223arCOG02014Anthranilate/para-aminobenzoate synthases component Ianthranilate synthase alpha chain

HOG Organism Gene ID Name Annotation
cHOG0222 nrc1 VNG1647 trpE1 anthranilate synthase alpha chain
cHOG0222 hmu HMUK1769 Hmuk_1769 anthranilate synthase component I( EC:4.1.3.27 )
cHOG0222 hma RRNAC1518 trpE2 anthranilate synthase component I
cHOG0222 hwa HQ3167A trpE anthranilate synthase, component I
cHOG0222 hla HLAC1941 Hlac_1941 anthranilate synthase component I
cHOG0222 hbo HBOR10770 Hbor_10770 anthranilate synthase, component I( EC:4.1.3.27 )
cHOG0222 hut HUTA1283 Huta_1283 anthranilate synthase component I
cHOG0222 hvo HVO_2454 HVO_2454 trpE anthranilate synthase component I
cHOG0222 nph NP3342A trpE_1 anthranilate synthase component I
cHOG0222 hhi 2089 trpE2 anthranilate synthase component I
MUSCLE (3.6) multiple sequence alignment


1647|gene|nrc1      ----------MIETDRETFT-ALAD--DG---PAIVRVAADLDIDVAPLTAYDALVAD--
1941|gene|hla       ----MTESATPIDRSKAEFV-DLAADAEK---PAVVRASASLDADVTPLAAYATLVGE--
3342|gene|nph       ----------MPVISRSEFV-ELAG--DE---PAVIRLVAELDAAVEPLEAYAALTGRTT
1283|gene|hut       -------MTGEPSLSHDAFV-DLADA-DE---PGVIRVAVELDADVDPLAAYAAVTGRES
11518|gene|hma      ---------MTLDISREEFV-EHAKA-DR---PVVVRTAAELDVDVEPLTAYAALTGRTS
2089|gene|hhi       ---------MTLDISREEFV-EHAKA-DR---PVVVRAAAELDVDVEPLTAYAALTGRTS
3167|gene|hwa       -----MTDSTPLSKSRSAFVSELTESLDSTSEPLIAHITASLPT-VTPLTAYAALAAQ--
10770|gene|hbo      MTSVKGVADDRLSISREEFV-SLVESEDG---PVVAHLTADLPT-TTPLTAYAALTER--
                                  ..  *.   .   :    * : .  ..*   . ** ** ::.    

1647|gene|nrc1      ------ADDHAFLLESAEKTPASDPDGAFTPDTTTEETRHARYSFVGYDPAAVVTVD-PD
1941|gene|hla       -------GPYGFLLESGEKVASSDPDGAFTAD--GDVDKHARYSFVGYDPEAIVSVH-PD
3342|gene|nph       D---CSPADHTFLLESAEKVASSDPDGAFRAG--QGADRHARYSFVGYDPAAVVTVDAGA
1283|gene|hut       DSENANADEYAFLLESAEKVASSDPNGAFAPS--TD-DRHARYSFVGYDPVAVATVE-SD
11518|gene|hma      D---VAANDYTFLLESAEKVASSDPDGAFAPE--TD-DRHARFSFVGYDPRAVVTVT-GD
2089|gene|hhi       D---VAANDYTFLLESAEKVASSDPDGAFAPE--TD-DRHARFSFVGYDPRAVVTVT-GD
3167|gene|hwa       -------SEYGFLLESAEKTPSSDPDGAFAPDYATA-DRHARFSFVGYDPDAVITVS-PD
10770|gene|hbo      -------SDYGFLLESAEKTASSDPAGAFAPEHVTT-DRHARYSFVGYDPDAVITVG-PD
                             : *****.**..:*** *** .       .***:******* *: :*    

1647|gene|nrc1      DTTIT------RLRDDPITDLLDAPDHA--TGDVLDRLRSVMPAVPRRNIPTEDRQLLDG
1941|gene|hla       RTDVTRLGPAAEFVGDESDGDLGPD-----AGDAIDRIRAAFPDVSLRGFPDTDRQILSG
3342|gene|nph       EATV-------DVIDDRYEGFFEPN-----GGDTVATLRETLPDVPLRNFPETDRQTLQG
1283|gene|hut       GTDL-------DILDDRYADMLETN-----GGDVLDDLRAVLPDVERRGFPAHDRQTLSG
11518|gene|hma      ESEV-------EAFDDRYADLVTTD-----GGDVVDDLRAAMPDVALRNFPAMDRQHLEG
2089|gene|hhi       DSEV-------EAFDDRYADLVTTD-----GGDVVDDLRAAMPDVALRNFPDMDRQHLEG
3167|gene|hwa       EVES-------KTLGGRAAKYITTNDDNNSSGDVLDHLRTAMPKFPCVGFPDDDRHRLRG
10770|gene|hbo      GASV-------ETLGGRAARYVTPD-----GGDVLDRLRGALPDLPRVGFPDDDRQRLRG
                                  ..     . .       **.:  :* .:* .   .:*  **: * *

1647|gene|nrc1      GLVGFLAYDAVYDLWLDEVGVERPPTPLPDAEFAVTTRTLVFDRATDSVSLVCTP-VADA
1941|gene|hla       GFVGFLAYEAVYDLWLEEVGVKRPETEFPDAEFALTTRTVVFDDKEGTVELVFTPIVGVD
3342|gene|nph       GLVGFLAYDAVYDLWLDEVGVERPDSRFPDAQFMLTTKTLVFDDAAGTVSLVCTPLVRPG
1283|gene|hut       GLVGFLAYEAVYDLWLDEVGIDRPDSRFPDAQFALATKTLVFDHAEDTVSLVFTPVVRPE
11518|gene|hma      GLVGFLSYDAVYDLWLDEVGLDRPDSRFPDAQFVLTTSTVRFDHVEDTVSLVFTPVVRQG
2089|gene|hhi       GLVGFLSYDAVYDLWLDEVGLDRPDSRFPDAQFVLTTSTVRFDHVEDTVSLVFTPVVRQG
3167|gene|hwa       GLVGFLAYEAVYDIWLNEVGVDRPDTQTPDAEFVLTTKTISIDHTDKSVSLVLTPIVAPD
10770|gene|hbo      GLVGFLAYEAVYDLWLAEVGVERPETDTPDAQFVLTTKTLSFDHAEETATLVLTPVVAPD
                    *:****:*:****:** ***:.** :  ***:* ::* *: :*    :. ** ** *   

1647|gene|nrc1      DTATDVYDALEAEAKRVQAVLRDATAPATAGIEVTTERAGDRDAYTDAVETAATAVRDGE
1941|gene|hla       DDPATVYDDLVAEAERVGAELRDASPPTPDGIRVTDESADPREAYEEAVRTAKRHVLDGD
3342|gene|nph       DDPGALYDDLTAEADRVESVLAAAESPETGGFSPVEERAGPQEAYEDAVETAKEHVLDGD
1283|gene|hut       EDAGARYDELLAAVERVESLLADAGDPETGGFHRVHEDAGPQDEYEQAVERAKEHVLDGD
11518|gene|hma      EDAGERYGELVAEAERVEAVLSDLSPLSTGGFRREDEVAGPRDEYEDAVERAKEYVLSGD
2089|gene|hhi       EDAGDRYDELVAEAERVEGVLSNLSPLSTGGFRREDEVAGPRDEYEDAVERAKEYVLSGD
3167|gene|hwa       DDPGVIYDELVAEAADIRETLAAATQPDPGEFLQINSAAGSQAEYETAVRTAKQRVLDGD
10770|gene|hbo      DDPEAVYDELRAEAEDVATALRDAETPETGGFVRTSESSGPREEYEAAVRRTKDHVLDGD
                    : .   *. * * .  :   *       .  :    . :. .  *  **  :   * .*:

1647|gene|nrc1      VYQAVVSRTRELDGDIDPRALYDALRAVNPSPYMFLLAHGDHTVVGASPETLVAVHDDTV
1941|gene|hla       IYQGVISRSRELRGEVDSLGLYAALREVNPSPYMYVLRHDDRSIVGASPETLVSVQGDRI
3342|gene|nph       IYQGVISRTRELDGDVDTLGLYRALRDINPSPYMYLLDYDDLAVVGASPETLVSVRGREV
1283|gene|hut       IYQGVISRKRELYGDVDPLALYDSLRSINPSPYMYLLGYDDRTIVGASPETLVSVGGDLI
11518|gene|hma      IYQGVISRTRELYGDVDPLGFYEALRAVNPSPYMYLLGYDDLTIVGASPETLVSVAGDHV
2089|gene|hhi       IYQGVISRTRELYGEVDPLGFYESLRAVNPSPYMYLLGYDDLTIVGASPETLVSVAGDHV
3167|gene|hwa       IYQGVISRVREQYGEIDPLGLYASLREVNPSPYMYLLRHDDRHIVGASPETLVSVQDDRI
10770|gene|hbo      IYQGVISRVRELRGEVDPMGLYEALRAVNPSPYMYLLRHDDRHIVGASPETLVSVHGDRV
                    :**.*:** **  *::*. .:* :** :******::* :.*  :*********:* .  :

1647|gene|nrc1      VTNPIAGTCQRGASPVADRRLAGEMLADEKERAEHTMLVDLARNDVRRVSAPGTVSVPEF
1941|gene|hla       VSNPIAGTCPRGESPVEDRRLAGEMLADGKERAEHTMLVDLARNDVRRVSEPGSIRVEEF
3342|gene|nph       MSNPIAGTCPRGESPVEDRRLAGEMLADDKERAEHTMLVDLARNDVRRVSEAGSVRVEEF
1283|gene|hut       TSNPIAGTSTRGNSPVEDRRLAGEMLADEKERAEHTMLVDLARNDVRRVAEPGSVRVEEF
11518|gene|hma      VSNPIAGTCPRGNSPVEDRRLAGEMLADGKERAEHTMLVDLARNDVRRVAEAGSVRVPEF
2089|gene|hhi       VSNPIAGTCPRGNSPVEDRRLAGEMLADGKERAEHTMLVDLARNDVRRVSEAGSVRVPEF
3167|gene|hwa       VSNPIAGTCSRGSSPVEDRRLAGEMLADGKERAEHTMLVDLARNDVRRVADPGSVRVEEF
10770|gene|hbo      VSNPIAGTCKRGTSPVEDRRLAGEMLADGKERAEHTMLVDLARNDVRRVSEAGSVRVEEF
                     :******. ** *** *********** ********************: .*:: * **

1647|gene|nrc1      MRVLKYSHVQHIESTVTGTLAADADAFDATRAAFPAGTLSGAPKVRAMEHIDAIEATPRG
1941|gene|hla       MNVLKYSHVQHIESTVTGTLAGDADAFDATRATFPAGTLTGAPKVRAMEIIEELETTPRE
3342|gene|nph       MNVLKYSHVQHIESTVTGRLREDCDAFDATRASFPAGTLSGAPKIRAMEIIDDLERTPRG
1283|gene|hut       MNVLKYSHVQHIESTVTGTLAENSDGFDATRAAFPAGTLSGAPKIRAMEIIDDLEADPRG
11518|gene|hma      MNVLKYSHVQHIESTVTGRLAEDKDAFDAARATFPAGTLSGAPKIRAMEIIDELERSPRG
2089|gene|hhi       MNVLKYSHVQHIESTVTGRLAEDKDAFDAARATFPAGTLSGAPKIRAMEIIDELERSPRG
3167|gene|hwa       MNVLKYSHVQHIESTVTGTLASDADAFDATRATFPAGTLTGAPKIRAMEIVDELETAPRG
10770|gene|hbo      MNVLKYSHVQHIESTVTGTLADECDSFDATRAAFPAGTLTGAPKVRAMEIIDDLELTPRG
                    *.**************** *  : *.***:**:******:****:**** :: :*  ** 

1647|gene|nrc1      IYGGGVGYFSWTGDAELAITIRSGTIT---------------HTGDEDTLTVRAGAGVVA
1941|gene|hla       AYGGGVGYYAWTGDADFAIVIRTATLD---------ESPPDASGPDETAVTVRAGAGLVA
3342|gene|nph       VYGGGVGYYSWSGDADFAIVIRTATVE-----RGR-------GVAGTDRITVQAGAGIVA
1283|gene|hut       IYGGGVGYFSWNGDADFAIVIRSAAVE-----HGIDAVDGSGEKRTQDRITVQAGAGIVA
11518|gene|hma      PYGGGVGYFDWDGDTDFAIVIRSATVE---------------DEGDRDRITVQAGAGIVA
2089|gene|hhi       PYGGGVGYFDWDGDTDFAIVIRSATVE---------------DEGDRDRITVQAGAGIVA
3167|gene|hwa       VYGGGVGYYSWSGDADFAIVIRTATIEDNETTRSGTHQTESSAETAPSTVRVRAGAGIVA
10770|gene|hbo      VYGGGVGYYSWSGDADFAIVIRTATVE---------------RRGGEDVISVRAGAGLVA
                     *******: * **:::**.**:.::                       : *.****:**

1647|gene|nrc1      DSDPDAEYEETEAKMDGVLAAVDRLRTTDDGE----------------------------
1941|gene|hla       DSDPAAEYEETEQKMDGVLTAIDRIREGGDGD-----------------------SLSSD
3342|gene|nph       DSDPESEYEETEQKMDGVLEAIEAI-ETPRAE----------------------------
1283|gene|hut       DSDPASEYEETEQKMGGVIDALERI-ESPDED----------------------------
11518|gene|hma      DSDPESEYVETEQKMDGVLTALEEI-EGEPVD--------------------------VA
2089|gene|hhi       DSDPESEYVETEQKMDGVLTALEEI-EGEPVD--------------------------VA
3167|gene|hwa       DSDPASEYHETEQKMDGVLSALEQI-TTKPTEVTQTQTTQTDVDGDRNEETNEHAGDEVK
10770|gene|hbo      DSDPAAEYEETEQKMGGVLAAVERI-EREATD------------------------DGTG
                    **** :** *** **.**: *:: :      :                            

1647|gene|nrc1      -------AVHR
1941|gene|hla       DTLPAGTEVDE
3342|gene|nph       ------PEDQR
1283|gene|hut       -AETPVEEVSQ
11518|gene|hma      ERAAGHEEVTR
2089|gene|hhi       ERAAGHEEVTR
3167|gene|hwa       SQSSQTEEVSR
10770|gene|hbo      GDAPEVEEVSR