HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0220COG0614arCOG04233ABC-type Fe3+-hydroxamate transport system periplasmic componentiron (III) ABC transporter ATP-binding

HOG Organism Gene ID Name Annotation
cHOG0220 nrc1 VNG1369 hemV1 iron (III) ABC transporter ATP-binding
cHOG0220 hmu HMUK2791 Hmuk_2791 periplasmic binding protein
cHOG0220 hma RRNAC3375 btuF corrinoid ABC transporter substrate-binding protein
cHOG0220 hwa HQ1628A hemT ABC-type cobalamin/Iron(III)-siderophore transport systems, substrate-binding protein
cHOG0220 hla HLAC0880 Hlac_880 periplasmic binding protein
cHOG0220 hbo HBOR22980 Hbor_22980 ABC-type Fe3+-hydroxamate transport system, periplasmic component
cHOG0220 hut HUTA2494 Huta_2494 periplasmic binding protein
cHOG0220 hvo HVO_1110 HVO_1110 iron ABC transporter ATP-binding
cHOG0220 nph NP3814A btuF corrinoid ABC transporter substrate-binding protein
cHOG0220 hhi 610 btuF corrinoid ABC transporter substrate-binding protein
MUSCLE (3.6) multiple sequence alignment


1628|gene|hwa       -------------MLLRSQLSSIAHILLIVLVVTGGLGTLLL----------------IP
22980|gene|hbo      --------------------MRLRTLTFVTLLFVAAIVPAT-----------------GA
3814|gene|nph       --------------------MRTLSAVVFAIALVAVAAGAPV----------------AA
880|gene|hla        --------------------MRNRYVIAMALLVTTALVGGVAGPAAGAQPTMESSTIENP
13375|gene|hma      MYESPLAVDKYLLLLTPAYGMRRRSLVCVFVLLVGSFAG-------------------IT
610|gene|hhi        ----------------------------------------------------------MT
1369|gene|nrc1      -----------------MHRGRFATLVIVALAVTMTAPAGAL----------------AP
2494|gene|hut       -------------------MSRTIAGVLAVLLVVGGVAGVALS---------------PA
                                                                               .

1628|gene|hwa       TPTDAVDPRLSGHMHTHSYHSTSRIDSKTVHNTISATTAVSGDSNTKNHGSSVTTTACRY
22980|gene|hbo      ATAGAASM---------------------------------------------QTDSCTF
3814|gene|nph       APAADTAP---------------------------------------------ADPTCSF
880|gene|hla        TGGPSVHQ---------------------------------------------TDDACGF
13375|gene|hma      PASATAAT---------------------------------------------QAEGCSF
610|gene|hhi        SAAATADT---------------------------------------------QADDCSF
1369|gene|nrc1      QPPAQHAD---------------------------------------------ADRACSF
2494|gene|hut       AGQAATHE---------------------------------------------STVNCSF
                                                                             * :

1628|gene|hwa       PLTVTDATGTTVRIMSDPDRVVTLNPSAAQTMWEIGAQNEVVG--VSRYASYLNGTASKQ
22980|gene|hbo      PYTATDATGTEVTLDSDPERVVTLNPSAAQTMWELGASDEVVG--VSKYATYLDGADEKQ
3814|gene|nph       PVTETDATGTEVTVEERPERIVVLQPSAAQTVWELGAEDRVVGAPVVPYTSDLDGIEEAE
880|gene|hla        PVEMTDATGTTITLDERPERITTINPSAAQTLWEIGARDRVVG--VTQYAAYLDGAGEKT
13375|gene|hma      PVTMTDATGTEVTIEERPARVTTTNPSAAQTMWEIGGRSQVVG--LTQYASYLDGAESRT
610|gene|hhi        PVTMTDATGTEVTIEERPERVTTTNPSAAQTMWEIDGRSQVVG--LTQYASYLDGAESRT
1369|gene|nrc1      PVTEPDASNTAITLDSEPERVVTLNPSAAQTMWELGDRDAVVG--VSQFGTYLPTASQRT
2494|gene|hut       PITVTDANGANVTVSERPERVVTLAPSASQVVWELGAQDSVVGMPVNQYTSYLNGSSEKT
                    *   .**..: : : . * *:..  ***:*.:**:.  . ***  :  : : *    .  

1628|gene|hwa       NVS--GAGGPSVERVLAATPDLVLVPNSTHSASPDRIAQLRAQGLTLVVFPQATSLTAVI
22980|gene|hbo      NVS--GANGPSVERVLDANPDVVLVPNSTYAFAKDRVDQIRAQGTTVFVFETGSSLSFVA
3814|gene|nph       NVLQVDDFTVNQEAVVELDADLVLAPNIV---PDDTVTSLREADQQVFKFGFGTSLSFVA
880|gene|hla        DVS-AEGFGVSVERVVDTDPDLVLAPNAS---AGQ-VEALREQGLTVYHFPAATSVEDIA
13375|gene|hma      NVS--ASFGVNVERVVSTSPDLVIAPNAS---AGD-VTPLRQAGVTVYHLPAATTIEDIR
610|gene|hhi        NVS--ASFGVNVERVVGTNPDLVIAPNAS---AGD-VAPLRQAGLTVYHLPAATTIEDIR
1369|gene|nrc1      VVSGGQPSQTNVEAVVGLDPDLVLAPNTV---RNTTVTRLRSAGITVFQFRAATSIDGVV
2494|gene|hut       NVV-TDNGQPQIETIIGLEPDLVLAPNII---SSDAVEQLRDAGVTVYRFESASSIGDVV
                     *        . * ::   .*:*:.**         :  :*  .  :  :  .:::  : 

1628|gene|hwa       EKTERIGRLTGNCAAGDARATELQQSINRIERVT--EDT-DRPVGVNVFY-GYTSGNNTF
22980|gene|hbo      NKTEQIGRLTGNCEAGRQSAQEIRNSADLMREVL--ADE-DKPVALNYFY-TYTSGSNTF
3814|gene|nph       DKTALTGQLVDACDAAAEVNDDYWDRIDAVEERA--AAV-EDPHVMY-FTDNHTAGSGTF
880|gene|hla        EKTEITGRLVGNCEAAAETNEEMNQAVTDAENRT--ADL-DRPAALYPLGDGFVAGGNTF
13375|gene|hma      AKTTTIGRLTGNCEGASEANAWMDANVDAVRQVT--ADVEDRPTALYPLGGGYVAAGNTF
610|gene|hhi        AKTATIGRLTGNCEGASEANAWMDANVDAVRQVT--ADAEDRPTALYPLGGGYVAANNTF
1369|gene|nrc1      EKTATIGRLTGNCAAAAATTAEMRDRVAAIADAVPDTDS-ARPRVYYHLGDGYTAGPNTF
2494|gene|hut       EKTRLTGRLLGTYETATDVSARTQAAVEAYRNAT--TGA-ERPTVYYAMGGGFTAGPQTF
                     **   *.* .    .                          *     :   ..:.  **

1628|gene|hwa       IDEIIETGGLENGAANAG-LSGFVPITDESVVAIDPTWIVI--------PTSAP-LPKTP
22980|gene|hbo      IGDVMTTAGLTNGAAEAN-ITGFAPINTETVVEMNPEYIIV--------PTGAT-VPDTE
3814|gene|nph       IDDLITTAGGVNVAAEAG-IDGYDEINEEALVEWNPDVIVA--------SDAEP-LPETA
880|gene|hla        INEIMQIGGTDNVAAAEG--DGYPQLSNEIILQTDPKLILV--------TDPEASILDEE
13375|gene|hma      VTSLIELAGAENVAARNH--TQYPQLSDEVILQLDPDVLFV--------TENTATVAETE
610|gene|hhi        VTSLIELAGAENVAARNH--TQYPQLSDEVILRFDPDVLFV--------TENTANIAETE
1369|gene|nrc1      IGAAIEAAGGHNIAADVNTTSSYPQLSEEVIVSQDPDVVVTGVSADRLDATASALVAPSS
2494|gene|hut       IGDVIDAAGADNVASAAN-ISTYDTISTEVVVEENPDWIVV--------SGQSP-IPSDP
                    :   :  .*  * *:       :  :. * ::  :*  :.         .   . :    

1628|gene|hwa       AYNSTTAYQNNNIIRVETEHIQQPAPR-AIYAVETILQATHPAASDEYQQLE--------
22980|gene|hbo      AWNSTTAVQEGNIIEVNSNYLQQPAPR-SVDAAETIMQAVHPEAFEEYQSMK--------
3814|gene|nph       AYESTVAVEHGQVVTVDSNDVSQPAPR-LVYALETIADGL--------------------
880|gene|hla        PYASTTAGVEGNYVVMNVNYLNQPAPRSVIESTETLATAVEELQTEDEEAAD--------
13375|gene|hma      PYASTTAGETNSTVTVQVRNINQPAPRSVVSFAHNATAQLYPDRYDADSYVP--------
610|gene|hhi        PYASTTAGETNSTVSARARNINQPAPRSVVSFAHNATAQLYPDRYDADSYVP--------
1369|gene|nrc1      VVRNTTAYATGNVVAVNTNHINQPAPR-IVEPMARMANAFHNTTINTTLDAQ--------
2494|gene|hut       ALSNTTAIQENQTVRVDANFISQPGPR-VTQPLRTLATAFHPEAAADVTADPSTVSAPVC
                       .*.*   .. :      :.**.**                                 

1628|gene|hwa       ---TTTPSANTSSSESSESNVSQTTARQMRSTPSGVTA------------------TQTN
22980|gene|hbo      --AEAEATTTESTETTTQTTTAQSTTTQAVNDTTTSAQTA----------------TGAD
3814|gene|nph       ----------ADAETADRPTDA----------------------------------TVDD
880|gene|hla        ---GEDTTDGENGTNDGENGTSDGEDGTSDGEDG----------------------SESQ
13375|gene|hma      ---------RSAVTKTSEPTPADHTPSTDQST------------------------TDAS
610|gene|hhi        -----RSAVTPAVTQTSEPTPADHTPSTDQPT------------------------TDAS
1369|gene|nrc1      ------PSATTTATSTAPPTDA----------------------------------ADGT
2494|gene|hut       AADAMEPTTTESASATTTDSSAETTEMTTDSTTESTTAETVTLETNQTMDQATEQTTTAT
                                         :                                  :   

1628|gene|hwa       SPGFGIVHVVFTAIGSVIIVCIIF--PRE
22980|gene|hbo      TPGFGVALTLVSMLAAA----LLA--TRR
3814|gene|nph       QPGVGIAPAAAGLVLAVVAGLLVRTLRRR
880|gene|hla        APGFGVVTALIAALAAA----LIA--RRQ
13375|gene|hma      GPGFTAVGALAALLTLVCIQQVRR--RRP
610|gene|hhi        GPGFTAVGALLAVLALVST--LSR--RRP
1369|gene|nrc1      APGFGVAAAVCALAGAA----LVA--RR-
2494|gene|hut       GPGFGIVAALIALVGAG----TVT--RRQ
                     **.  . .                  *