HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0022COG1628arCOG00928 arCOG03012Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0022 nrc1 VNG0765 vng765 no entry
cHOG0022 nrc1 VNG2081 vng2081 no entry
cHOG0022 hmu HMUK0409 Hmuk_0409 conserved hypothetical protein
cHOG0022 hmu HMUK1182 Hmuk_1182 conserved hypothetical protein
cHOG0022 hma RRNAC1309 hypothetical protein
cHOG0022 hma RRNAC2799 hypothetical protein
cHOG0022 hwa HQ1378A hypothetical protein
cHOG0022 hla HLAC0382 Hlac_382 hypothetical protein
cHOG0022 hla HLAC1785 Hlac_1785 hypothetical protein
cHOG0022 hbo HBOR27530 Hbor_27530 hypothetical protein
cHOG0022 hbo HBOR10860 Hbor_10860 hypothetical protein
cHOG0022 hut HUTA0270 Huta_0270 conserved hypothetical protein
cHOG0022 hut HUTA1766 Huta_1766 conserved hypothetical protein
cHOG0022 hvo HVO_0442 HVO_0442 death domain-associated protein
cHOG0022 nph NP0088A hypothetical protein
cHOG0022 nph NP0668A hypothetical protein
cHOG0022 hhi 1900 HAH_1900 hypothetical protein
cHOG0022 hhi 80 HAH_0080 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


88|hp|nph         --MGFGSYDESEQENQQLDTDDIED--GGQSTLPTHDGEVEFEYDDASSEDLLETYERLQ
10860|hp|hbo      --MGFGSYDESEQERQQSN--EDDDAEGITTHEHEHEGSVTVES-DVSTDALIDRLGEMK
2081|hp|nrc1      --MGFGSYDESEQDTQSIDSEDVAAADEMDTAEHEHDGGVDYEI-GASNDELLDRLQEIK
1378|hp|hwa       --MGFGSYDESEQENQDFET-DLEDDDGVSTSQSDHSGEVEYEI-GASNDELLNRLKDIK
27530|hp|hbo      --MGFGSYDESEQESQDYDQ-DLDENDGVATSENDHDGEVNFEN-GASNEELLDRLQEIK
12799|hp|hma      --MGFGSYDESEQDNQEYDT-DFEDEDGLDAEENAHEGDIEYEF-TASNDELLDRLEDIK
80|hp|hhi         --MGFGSYDESEQDNQEYDT-DFEDEDGLDAEENAHEGDIEYEF-TASNDELLDRLEDIK
382|hp|hla        --MGFGSYDESEQENQDLDA-DFDDDDGVQAAEEVHEGSVDYEP-GASNDELLDRLQEIK
1766|chp|hut      --MGFGSYDETEQENQDLDA-DFDDDDGVNAAENTHDGDLEFEF-TASNDELIDQLSDIK
270|chp|hut       --MGFGSYDESEQENQASGS-DIDDSESVDVDATDHDGDVNFET-NASQDELLDKLQDMK
765|hp|nrc1       MHMGFGSYDESEQKDQSVDT---DEDKGVSVHENDHDGEVSFDS-EADSEELIDQLKSIK
668|hp|nph        --MGFGSYDESEQQDQNVET---DEDAAVNVHENDHEGEVEFEF-DENEDALIDRLQDMK
11309|hp|hma      --MGFGSYDESEQKDNDVDA---DDSEGVAVHENDHDGSVSFET-EATTSDLVDKLGDMK
1900|hp|hhi       --MGFGSYDESEQKDNDVDA---DDSEGVAVHENDHDGSVSFET-EATTSDLVDKLGDMK
1785|hp|hla       --MGFGSYDESEQKDQDVDT---DDDNAVNVHENDHDGEVTIEG-GASTDDLVGRLSEMK
                    ********:**. :                   *.* :  :      . *:     ::

88|hp|nph         GE-----
10860|hp|hbo      DEE----
2081|hp|nrc1      DQSS---
1378|hp|hwa       DN-----
27530|hp|hbo      DN-----
12799|hp|hma      DNQNT--
80|hp|hhi         DNQNT--
382|hp|hla        SEET---
1766|chp|hut      ENT----
270|chp|hut       D------
765|hp|nrc1       DE-----
668|hp|nph        DDDDDGD
11309|hp|hma      DEDEE--
1900|hp|hhi       DEDEE--
1785|hp|hla       DDEDDE-