HOG Organism Gene ID Name Annotation
aHOG2197 hbo HBOR23220 Hbor_23220 universal stress protein UspA-like protein
aHOG2197 hwa HQ1613 usp homolog to stress response protein
aHOG2197 hma Hma_13125 usp33 universal stress protein
MUSCLE (3.6) multiple sequence alignment


13125|gene|hma      --MYEIVAGIDKSEARGTAIAESITEIPMDASQVRVTLLHDFEENPEGASVDQVASVRRA
23220|gene|hbo      --MYHVVIGIDDEETHAHRCVEAVVNLPGDFDEKKVTLIHSFIDNPSGASATQVHSVREA
1613|gene|hwa       MSMYHIVAGIDDDEAHATRCAEAAIDLPSESPEKQVTLIHSFDDNPSGASASQVQSVRTA
                      ** :* ***..*:..   .*:  ::* :  : .***:*.* :**.***. ** *** *

13125|gene|hma      REVLEDAGVEVALEESSGEPADAILRLADEQDVDMIVVAGRKRTPTGKVLFGSVTQSVIL
23220|gene|hbo      GEMLEEHGIEYTVEESSGDPANAIVSVGDETDADLIVVGGRKRSPAGKALFGSVTQSVIL
1613|gene|hwa       AELLEEHDIDTNIQESSGDPADAIIDTAVEDEADLILIGGRKRSPAGKALFGSVTQSVIL
                     *:**: .::  ::****:**:**:  . * :.*:*::.****:*:**.***********

13125|gene|hma      GTDRSVLVCSGEEE
23220|gene|hbo      GATRPVMVTGVED-
1613|gene|hwa       GSTRPVMVTGVDEE
                    *: *.*:* . ::