HOG Organism Gene ID Name Annotation
aHOG2191 hbo HBOR33890 Hbor_33890 hypothetical protein
aHOG2191 hwa HQ2133 hypothetical protein
aHOG2191 hwa HQ2170 hypothetical protein
aHOG2191 hwa HQ3579D hypothetical protein
aHOG2191 nrc1 VNG6418 vng6418 no entry
aHOG2191 hma Hma_6113 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


6418|hp|nrc1      -------MQQTLVGCAFCDAPPGTETGEAHTWGQDERVTHPICVDCAIQERPDSNDLDHH
6113|hp|hma       -------MQQTLAGCAFCEAPSGIETGIAYTWGKEERVNHPICVDCAIQETPDPDDRDHY
2133|hp|hwa       -------MQQTLSGCAFCDSPPGSQMGEAHTWGKDERVTHPICVDCAVQERPDPEERDHH
3579|hp|hwa       -------MQQTLSGCAFCDSPPGSEMGEAHSWGKDERVTPPICVDCAVQERPDPEERDHH
2170|hp|hwa       MPTGKPSDAAALVGCAFCDAPPGTETGEAHTWGTDERVTHPICVDCAIQTESDPDKRNRY
33890|hp|hbo      ----------MLTGCASCDAPPGTETGKAHTWWQDERVTHPICVDCAIQREPNPDERDHV
                             * *** *::*.* : * *::*  :***. *******:*  .:.:. :. 

6418|hp|nrc1      AYDGCGRIVDTLPA----------------LTSFHVELGHLDGTVHLCVRCSPGGPATYW
6113|hp|hma       ACDSCGLVVNALAA----------------LTRFRIELGHLEGPIQVCARCSPGGPATYW
2133|hp|hwa       TCDGCGLVVDALAA----------------LTRFRVELGHLEGPLQFCARCNPGGLATYW
3579|hp|hwa       TCDGCGLVVDALAASPALPPAASGTFGPAQLTRFRVELGHLEGPLQFCERCNPGGLATYW
2170|hp|hwa       ACDGCGVVVDTLAA----------------LTRFRVELGHLEGPLQLCERCSPDGLATYW
33890|hp|hbo      ACDGCGLVVDTLAA----------------LTRFRVELGHLEGPLQLCARCSPGGLATYW
                  : *.** :*::*.*                ** *.:*****:*.::.* **.*.* ****

6418|hp|nrc1      TRDLEEHLVADINSE
6113|hp|hma       TRDLEAHIVSD----
2133|hp|hwa       TRDLEEHLVQEVSE-
3579|hp|hwa       TRDLEEHLVQEVSK-
2170|hp|hwa       TRDLEGHLVSES---
33890|hp|hbo      TRDLEEHLVATPAE-
                  ***** *:*