HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0219COG3390arCOG02258/1Uncharacterized protein conserved in archaeareplication factor A related protein - rfa32

HOG Organism Gene ID Name Annotation
cHOG0219 nrc1 VNG1253 rfa7 replication factor A related protein - rfa32
cHOG0219 hmu HMUK2419 Hmuk_2419 conserved hypothetical protein
cHOG0219 hma RRNAC1135 hypothetical protein
cHOG0219 hwa HQ2404A hypothetical protein
cHOG0219 hla HLAC0624 Hlac_624 hypothetical protein
cHOG0219 hbo HBOR18980 Hbor_18980 uncharacterized conserved protein
cHOG0219 hut HUTA0545 Huta_0545 conserved hypothetical protein
cHOG0219 hvo HVO_1337 HVO_1337 conserved protein
cHOG0219 nph NP3962A hypothetical protein
cHOG0219 hhi 1741 HAH_1741 hypothetical protein
cHOG0219 hhi 44 HAH_0044 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


44|hp|hhi          MGLFDTIRRAVGGDDSSTDGDERAAGGDPPSDDGPDLLDTATLDPTTFREYAEHVVDGAD
2404|hp|hwa        --------------------MSTTQN---SREVAYRLFAAE-FEDATL-SYSAGDDERAP
545|chp|hut        -------MSAENGDGDADDGGDDSPG---RREVAYRVFAAE-FDDSDF-DYSESDADRAP
624|hp|hla         -------------------MSDDGPG---AREVAHRVFAAE-FDDASL-SYSESDEERAP
18980|hp|hbo       --------------------MSAVEN---RREVAYRIFAAE-FDDASL-SYSEGDEERAP
1253|chp|nrc1      ----------------MSDADTDDDGERNRREVAYRLFAAE-FDDADF-SYAESDEERAP
3962|hp|nph        -------------------MSSSGPG---RREVAYRLFAAE-FDDAEF-SYSESDEERAP
11135|hp|hma       ----------------MSESGDSGPG---RREVAHRLFAAE-FDDADF-SYSESDEERAP
1741|hp|hhi        ----------------MSESGDSGPG---RREVAHRLFAAE-FDDADF-SYSESDEERAP
                                            .     : .  :: :  :: : : .*:    : * 

44|hp|hhi          PLTFDPDALARLDTAIEESYDGKTVGDAASVTTYTENTVRFGSYLGELLVRAYDGKWVQS
2404|hp|hwa        NYVVTPTG-ERINRLF-------TVGALTAVESVTDDLRR--------------GRIADP
545|chp|hut        NYVVTPTG-ARVNRLF-------AVGVLTEVSPAGEDVLR--------------ARIADP
624|hp|hla         NYVVTPTG-ARVNRLF-------VAGVLTEVERVNDETRR--------------GRVVDP
18980|hp|hbo       NYVVTPTG-ARVNRLF-------AVGALTEVESVNDEVLR--------------GRIADP
1253|chp|nrc1      NYVVTPTG-ARVNRLF-------VVGVLTAVEAVNDDVVR--------------ARVVDP
3962|hp|nph        NYVVTPTG-ARVNRLF-------AVGVLTEVEDVNPEMVR--------------GRVVDP
11135|hp|hma       NYVVTPTG-ARVNRLF-------LVGVLTELEQVNDDVLR--------------ARVVDP
1741|hp|hhi        NYVVTPTG-ARVNRLF-------LVGVLTELEQVNDDVLR--------------ARVVDP
                     .. * .  *::  :        .*  : :     :  *              .. .:.

44|hp|hhi          DGRWGVAVAGPNDEVGVAVFDVAARSFADKPVFAAVVTRL------ESDLELDSIQSTDD
2404|hp|hwa        TGVF-VTYAGQYQPTAASFLEQ-----ATPPMFVALTGKARTYQPEDSDQVLTSARPED-
545|chp|hut        TGTF-VVYAGQYQPDAQTFLER-----AEPPAYVAVTGKARTFQPDDSDVVYTSIRPES-
624|hp|hla         SGAF-VTYAGQYQPEAQTFLER-----AEPPAFVALTGKARTFEPEDSDRVFTSVRPES-
18980|hp|hbo       TGVF-VTYAGQYQPEAMNFLDR-----STPPMFVSITGKARTYEPDDSDRVFTSVRPES-
1253|chp|nrc1      TGAF-VVYAGQYQPEALAALEA-----AETPSFVAVTGKARTFEPDDADVVYTSVRPET-
3962|hp|nph        TGAF-VTYAGQYQPDELAFLER-----TDPPTFLALSGKARTYEPEDGDRVFTSVRPES-
11135|hp|hma       TGPF-VIYAGQYQPDELAFLEA-----ADPPMFVAVTGKARTFQPDDSDRVFTSVRPES-
1741|hp|hhi        TGPF-VIYAGQYQPDELAFLEG-----ADPPMFVAVTGKARTFQPDDSDRVFTSVRPES-
                    * : *  **  :      ::      :  * : ::  .       :.*    * ..   

44|hp|hhi          GGLTEPGADEIDADS----VVSEPTRVVSRVD--------DGQADERDGPPEPTATDERS
2404|hp|hwa        -------LTAVDTDTRDRWAVSAAQATLRRIGIMDIAQSLPVRGDALENELESRGVDEAR
545|chp|hut        -------LNEVDEVTRDRWTVGAAEATLERVGTMATAMELDVRGDELRAALDERGVEPGL
624|hp|hla         -------LNAVDADTRDRWVVSAAEATLDRLAVFAKALDSELRGEELRVALETGGAPAAL
18980|hp|hbo       -------INEVDAGTRDRWVVAAARATLERVATMQAALAMDHRGDDLRAALEARGVDESL
1253|chp|nrc1      -------VSEVDADTRDRWVVATAERTLSRVRTAAAAHDRVERGDSLESALAAAGVAPGL
3962|hp|nph        -------ISEVDADTRDRWVITAAERTLDRIGIVASAIEADLAGDQLRAALEADGVDERL
11135|hp|hma       -------ISEVDADTRDRWVVQAAEQTVSRIGQMASAKQAGLAGDELRLALLDRGIDESA
1741|hp|hhi        -------ISEVDADTRDRWVVQAAEQTVSRIGQMASAKQAGLAGDELRLALLDQGIDESA
                             :*  :    .:  .  .: *:            .:         .     

44|hp|hhi          EATAGDTADTDSSQAIETEPTRIVRRVESESEGEDRPDDTDPTPATSEVADEPENEPP--
2404|hp|hwa        AEGMALAIDHYGTTEFYLESLRKSVIQVLEVIAGNRETVEALDTNPSETGAASLGALP--
545|chp|hut        AAGIPLALDHYGTTPGYLAAMRTLATSALEVVAGERSEVESLSLSPDQGGDADLDALA--
624|hp|hla         AAGIPKAIAHYDTSTAYVEALRRLAVDALKLIAGDRDEVRSPDIAPDAGGEAAIGALP--
18980|hp|hbo       AMGVPLAIDHYGTTEHYLEAVRTLAVQALELVADKREAVDSLTVAPDETGPSELGPVPDV
1253|chp|nrc1      ASGIPRAFDHYGTTPAYLGAVRDLAADAARVVAGDTDTVGGLAVAPSEAGDATLDFAA--
3962|hp|nph        ADGVALALDHYGTTPDYLDALRELAVDAVRVVAGERDEVGRLDIAPGEGGGDATALAA--
11135|hp|hma       AAGITLALDHYGTTGDYLDALRTTALDAARVVADDTDEAQGLSLSPDDGTDDPIPLLA--
1741|hp|hhi        AAGITLALDHYGTTGDYLDALRTTALDAARVVAGDTDEAQGLSLSPDDGTDDPIPLLA--
                         :    .:      . *          . .          ..          .  

44|hp|hhi          -----WSSDDADSSTADIGEDADPETTESAS-DDAGSELSAAKTTEEGSTIDSSDAEPAT
2404|hp|hwa        -----SIAIDTTQTSTPSPTSTPSPTSTSESIQDSAHDTNDAVDNDNVATESDTDTTVTT
545|chp|hut        --------------ET----------------ASIGEPAGETVGTAEQGESPATENEETP
624|hp|hla         --------------ETDVTIEAP---------AEPVADDGAVESESESVAAESDESASEP
18980|hp|hbo       AAATAPEGGDVAITESDESEASGSEPVSDEPTESAATAADEPATTEADATAEKTEPATET
1253|chp|nrc1      ----------------------------------------DLGADASFGGASETDAETQP
3962|hp|nph        ---------------LDLSGAPS---------PETAAAAAGIGDADDAGAGVEAEPEPET
11135|hp|hma       --------------SLDLDTDVSTP-------ETATEDAEGDATATDSGATEPTTDEEVA
1741|hp|hhi        --------------SLDLDTDVSTP-------ETATEDAEGDATATESGATEPTTDEEVA
                                                                              .

44|hp|hhi          EPAAEQSAVDTADEQPTAETPAADSTFDAAEDGPTADTTDAVETTADADDTADMATADEA
2404|hp|hwa        ESSPSQEATIDTDIVQPAADGESTVESASEPDEYATSDPITPKNDGENG--VTTTEAENA
545|chp|hut        STGETTSTVDTSASTADASPSADD------------TASTT--ADSDAG--AASEESASA
624|hp|hla         EPNAESEPAVTGDETADSTEADSTETDSTETDSTETDSIET--DTEDTA--VSVETEPSD
18980|hp|hbo       EPVTETEPAPTTDETEPETPTESGSAEAAADAETV-AATDS--GTSEAA--ADTPEPESS
1253|chp|nrc1      DS-----------------------------------------SAGDAG--APAGTPDST
3962|hp|nph        ETETDTEPAGASDSEPAETTGTDDALSGDGRDATGVDEPLA--GSDEAA--TASDGPETT
11135|hp|hma       DAAEKGAPADAADAEPA--PGSPGAPAGDES-----TEPDA--GAAASD--APVETPETA
1741|hp|hhi        DAAEKGAPADAADAEPA--PGSPGAPVGDES-----TEPDA--GAATSD--APVETPETA
                   ..                                                 .        

44|hp|hhi          AAYIDEAEPTADSATADPSDEAPAAETLPEDSAIDTRDEDRTV-----------------
2404|hp|hwa        T-ADDSLSADVTEDSAPSDEMTETVNTTAQDINSTETHLETEIQREVDESEISTDTENTS
545|chp|hut        STADVSGESDAAEGDGFDSDETPEAESATETSEER-------------------------
624|hp|hla         S-------GSDAAGSVDAGPGSADSESDDESGGLGDFDA---------------------
18980|hp|hbo       A----GGLGDFDAGTSESETSETTADTSDSAGGLGDFDADDSVPSGSGDTESAPEAIEPD
1253|chp|nrc1      A------------SSVDTDDGEPASETASPDGDAGPS-----------------------
3962|hp|nph        TPADEPTADTAERSATDALDESPTAEAAPAAGSEPGAVD---------------------
11135|hp|hma       T---DAAADETTPGESVGEDVSSTPEQSEPVDEPPVS-----------------------
1741|hp|hhi        T---DAAADETTPGESVGEDVSSTPEQSEPVDEPPVS-----------------------
                   :                        :                                  

44|hp|hhi          ---------------DAPAGAATDTSADEAVTD---TADD----------GAAG-----T
2404|hp|hwa        APTSASNSDIMS---SDEGIDVESGNSDESTAGSADTDDDITADP-----TEM------Y
545|chp|hut        ---------------SETDTDTQAAETDTPTDD---PSED---------TADLEDFDGEF
624|hp|hla         ---------------GTDDTETDESGTDDAEADLDEPSSEPGS-------DEM------Y
18980|hp|hbo       AETSDPTTDTETAADTEPTTDTETATADSPSEA---VQADAAADASSAMTGEM------Y
1253|chp|nrc1      ---------------TGPVTDGESGAADED--------------------GEM------Y
3962|hp|nph        ---------------TEPPSAGDAG-LDESDAEADSPDDDFDP-------GE-------F
11135|hp|hma       ---------------SEPVTDADAMGQDEPESSSE-PDDG----------GDLGDFDTEF
1741|hp|hhi        ---------------SEPVTDADAMGQDEPESSSE-PDNG----------GDLGDFDTEF
                                              *                                

44|hp|hhi          SIDDESKPDISPDASSDVATDAEAVSETTGDESPADTADAAGVDDTP-------------
2404|hp|hwa        ELDDDERAEIEDEFVTEFSTGNEV------DAPGSADIDVPTAPDEDPSDEETSVDTTTN
545|chp|hut        ELDEDEREQIKDEFGTEFTSGAEV------DEPGEAGIETPDEPI---------------
624|hp|hla         QLDDEEREEIESEFGTDFSTGTEV------DEPGEADIDVPDPEEIEES-----------
18980|hp|hbo       EMDDEERAEIEAEFGAEFSTGNEV------ADPGEADIDVPDADELE-------------
1253|chp|nrc1      ELSAEEREAVKDEYGVDFSTGDEI------PEAGEHDIDAPGPDE---------------
3962|hp|nph        DLDEEEREEIKEEFGTEFSTADEV-------EPADIEPEAGDGADDA-------------
11135|hp|hma       ELDEDEREEIEQEYGTDFQSGTEV------DEPGEADIETPDHEELA-------------
1741|hp|hhi        ELDEDEREEIEQEYGTDFQSGTEV------DEPGEADIETPDHEELA-------------
                   .:. :..  :. :   :. :  *         .     :.                    

44|hp|hhi          -----AAVAESDAVEQSDDRPDTSAPVGDVEASDATETAPSQDATADETPDTAAADE---
2404|hp|hwa        VTETASIDTGSTDGDPHETPIESDTDTDTDTDTDTDTDTDIAVDGISE--ASPAGSGDLG
545|chp|hut        -----------------EPETAGDDEGTPATEETADEAAPAAEKTD----TTTEGEP---
624|hp|hla         -----PTSVGASESAGADAPAGSADEAA----------------------AEPTTDS---
18980|hp|hbo       -----AEGAEASAETNGETPSGVADSSDTVESDTTEAATEPKTEMDEPLEPETDETP---
1253|chp|nrc1      -------------GVESEAAAASTDDGG----------------------DAVADPG---
3962|hp|nph        -----EPGQESSSESEPEPEPGLEAESEPEPEVETESEPEPEVETESE--PEPGVET---
11135|hp|hma       -----DAAQEGAPADAADAEPAPGSPGAPAGDESPEPTADAATS------DAPAETP---
1741|hp|hhi        -----DAAQEGAPADAADAEPAPGSPGAPAGDESPEPTADAATS------DAPAETP---
                                    :                                          

44|hp|hhi          ------REQPASTGSDSTAGSMARS--WEPGTVRADHADTAVEFADFWGEHDLDFSPASL
2404|hp|hwa        DFETTVDFDSESTESNSSASETRSN--EGETESGTETSAESTNIADSNKTQDVDLEQAAV
545|chp|hut        ------EPAAEEPGSEELASGADES--AA-------------------EPEDIDLEDAAM
624|hp|hla         ------EPESEEPAGDETSD----------------------------ADADIDLEAAVI
18980|hp|hbo       ------ESDTDETASDESKESGKSEQSDESEQSGKSEVAADTTEATDEPAEDVDLEVAVV
1253|chp|nrc1      ------DFDADGTGDDS-------------------------------PPADVDVEEYVV
3962|hp|nph        ------EPEAADTGESAAADDLPGD------------ADGETGVDDGGTADDVDLEAAVS
11135|hp|hma       ------ETATDAAADETTPDESASE--DA-------------------PTEDVDLEDAVM
1741|hp|hhi        ------ETATDAAADETTPDESASE--DA-------------------PTEDVDLEDAVM
                            .  .  .                                   *:*..    

44|hp|hhi          SRLDDLVDAEWDDERFAETTFGSDDSFDDRAFTSVVRELGGYFGEVLVRQLDGKWTDETD
2404|hp|hwa        SMMNELDDGD-----------------------------GATREAVINEVVDMHDVSPDA
545|chp|hut        EAMATLDDGD-----------------------------GADREAVIERVQDAHGVDAAD
624|hp|hla         DAMGALDDGA-----------------------------GADREAVVEAVVDDHGVAADA
18980|hp|hbo       DVMADLDDGD-----------------------------GADHDAVVSTIVEQYGADADA
1253|chp|nrc1      ELMDDLDDGD-----------------------------GVPRSEVVSTAADSLGVDADE
3962|hp|nph        EAMASLDDGD-----------------------------GAAREELVSTVADEQGVSADA
11135|hp|hma       AVMDDLDDGS-----------------------------GADREELRSTVVSRHGADADA
1741|hp|hhi        AVMDDLDDGS-----------------------------GADREELRSTVVSRHGADADA
                     :  * *.                              *     :     .   .    

44|hp|hhi          HEAAVVVGGPGGQFAIPVFEVAITSLRKQAVFGRSYDALLEDLGRDGPTR--
2404|hp|hwa        VESAI---------------------QSALMSGRCYES------GENALKAI
545|chp|hut        VEDAI---------------------QDALMNGRCYEP------SDGRLKSI
624|hp|hla         VEDAI---------------------QDALMSGKCYEP------GDGTLKPI
18980|hp|hbo       VEDAI---------------------QDALMSGKCYEP------SEGTLKSI
1253|chp|nrc1      VEAAV---------------------TSALMSGRCYES------GDDRLKAI
3962|hp|nph        VEDTI---------------------QEMLMGGRCYEP------QDGVLKPI
11135|hp|hma       VEDAI---------------------QDALMGGRCYEP------EDGKLTPI
1741|hp|hhi        VEDAI---------------------QDALMGGRCYEP------EDGKLTPI
                    * ::                      .  : *..*:.       :.