HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0218COG2058KOG3449 KOG1762arCOG04287/3Ribosomal protein L12E/L44/L45/RPP1/RPP250S ribosomal protein L12P

HOG Organism Gene ID Name Annotation
cHOG0218 nrc1 VNG1103 rpl12p 50S ribosomal protein L12P
cHOG0218 hmu HMUK2184 Hmuk_2184 ribosomal protein 60S
cHOG0218 hma RRNAC1418 rpl12p 50S ribosomal protein L12P
cHOG0218 hwa HQ2901A rpl12p 50S ribosomal protein L12P
cHOG0218 hla HLAC2533 Hlac_2533 ribosomal protein 60S
cHOG0218 hbo HBOR12230 Hbor_12230 LSU ribosomal protein L12AE
cHOG0218 hut HUTA0256 Huta_0256 ribosomal protein 60S
cHOG0218 hvo HVO_2755 HVO_2755 L12P 50S ribosomal protein
cHOG0218 nph NP4448A rpl12p 50S ribosomal protein L12P
cHOG0218 hhi 2000 rpl12p 50S ribosomal protein L12P
MUSCLE (3.6) multiple sequence alignment


4448|gene|nph       MEYVYAALILHESGEELNEDNLTDVLDAAGVDVEESRVKALVAALEDVDVEEAIETAAAV
2901|gene|hwa       MEYIYAALTLNESGESITEDAVTEVLEAAGVDVEDSRVKALVAALEDVDIEEAIDTAAAA
1103|gene|nrc1      MEYVYAALILNEADEELTEDNITGVLEAAGVDVEESRAKALVAALEDVDIEEAVEEAAAA
2533|gene|hla       MEYVYAALILNETGEEINEDNVTGVLEAAGVDVEESRVKALVAALEDVDIEEAIETAAAA
11418|gene|hma      MEYVYAALILNEADEEINEDNLTDVLDAAGVDVEESRVKALVAALEDVDIEEAVDQAAAA
2000|gene|hhi       MEYVYAALILNESGEEINEDNLTDVLDAAGVDVEESRVKALVAALEDVDIEEAVDQAAAA
256|gene|hut        MEYVYAALILNETGEEINEDNLTNVLDAAGVDVEESRVKALVAALEDVDIDEAVEEAAAV
12230|gene|hbo      MEYVYAALILNESDEEVNEENVTAVLESAGVDVEESRVKALVAALEDVDIEEAVETAAAA
                    ***:**** *:*:.*.:.*: :* **::******:**.***********::**:: ***.

4448|gene|nph       PAGGAGGAAAGGAAEADEAEEADEGGDADEAEEAEEEAEDDGDDEDGGEGLGELFG
2901|gene|hwa       PAPAAG-AGAASEAEVEDEADTDE-EEPDETEEEEADEADDEDDEASGEGLGNLFG
1103|gene|nrc1      PAAAPAASGSDDEAAADDGDDDEE-ADADEAAEA-EDAGDDDDEEPSGEGLGDLFG
2533|gene|hla       PAAGAAAGGSADAADADEAADESD--DEDDAAEEAADDEDEDDD--GGEGLGELFG
11418|gene|hma      PVPASGGAAAPAEGDADEADEADE-EAEEEAADDGGDDDDDEDDEASGEGLGELFG
2000|gene|hhi       PVPASGGAAAPAEGGADEADEADE-EAEEEAADDGGDDDDDEDDEASGEGLGELFG
256|gene|hut        PAATGGAAGGEVEADDEGGDDAEE-ADEEEAADE-AEGGDDEDEDASGEGLGELFG
12230|gene|hbo      PAPAAGGAGGEVEAAGDDDDDEGG-EEEEEAAEE-----EEEDEEASGEGLGELFG
                    *.   . ...   .  :   :       ::: :      :: *:  .*****:***