HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0217COG0546 COG1255arCOG04385hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0217 nrc1 VNG2608 vng2608 no entry
cHOG0217 hmu HMUK0305 Hmuk_0305 HAD superfamily (subfamily IA) hydrolase, TIGR01548
cHOG0217 hma RRNAC2106 hypothetical protein
cHOG0217 hwa HQ1376A hypothetical protein
cHOG0217 hla HLAC0335 Hlac_335 HAD superfamily (subfamily IA) hydrolase, TIGR01548
cHOG0217 hbo HBOR27640 Hbor_27640 haloacid dehalogenase superfamily protein, subfamily IA hydrolase, TIGR01548
cHOG0217 hut HUTA0328 Huta_0328 HAD superfamily (subfamily IA) hydrolase, TIGR01548
cHOG0217 hvo HVO_0431 HVO_0431 HAD superfamily (subfamily IA) hydrolase
cHOG0217 nph NP0770A hypothetical protein
cHOG0217 hhi 2596 HAH_2596 HAD-superfamily hydrolase
MUSCLE (3.6) multiple sequence alignment


1376|hp|hwa         MDADAVVLDIDGVLIDVSQSYRRAIVDTVDRCYNQTIKRTDIQEFKNAGGFNNDWDVTNA
2608|chp|nrc1       MEVDAVVLDVDGVLVDVAESYRRAIVEAVEHVYGDTIERADIQQFKDAGGFNNDWTVTDA
770|hp|nph          MNVDSVILDIDGVLVDVEDSYRRAIVESIAHVYGDTIDKADIQLFKDAGGFNNDWELTYA
328|gene|hut        MQSDAVVLDVDGVLVDVADSYRRAVVDTVARIHGETISRSTLQAFKDAGGFNNDWELTDA
27640|gene|hbo      MHADAVVLDVDGVLVDVADSYRRAIVESIARLYDRTIDKSDVQQFKDAGGFNNDWELTYA
12106|hp|hma        MQVDAVVLDIDGVLVDVADSYRRAIIESIERVYGDTIEKAAVQQFKDAGGFNNDWELTYA
2596|gene|hhi       MQIDAVVLDIDGVLVDVADSYRRAIVESIDQVYGDTIKKAAVQQFKDAGGFNNDWELTYA
335|gene|hla        MQVDAVVLDIDGVLVDVADSYRRAIIESVERVCDKTIDRDAIQLFKDAGGFNNDWELTDA
                    *  *:*:**:****:** :*****::::: .  . **..  :* **:******** :* *

1376|hp|hwa         VALYILTTRH--ESVSVDQFTTQIAAHGGGLESALTVVDNYLSTADYEMVLDAWNSDRLR
2608|chp|nrc1       AALWVLASRENGTIGGVGAFTDAIAEHGGGLAGAEAVVDASLGPAAVERVRDAWEPERLR
770|hp|nph          AALYVLARRE-KPALSIETYTGLIAASGGGLQAAETAIADELPPAAREKVLAEWDRKRLR
328|gene|hut        LALYVLARSE-GFDRCVEGFTDRIAASGGGFSGARSVVDDEMDAAARERIYAALDREQLR
27640|gene|hbo      AALYLLADDR--EPISIAEFTDRIHERGGGLDAAEAVTEAHLDADDYDAVREAWDPEGLR
12106|hp|hma        AALFVLAGRE-STVADIAAFTDAIAERGGGLDAAEAVVRDLLDDPAEDRVFDAWNREQLR
2596|gene|hhi       AALFVLADRE-SAVSDLAAFTDAIAERGGGLDAAEAVVRDLLDESAETRVFDFWDPERLR
335|gene|hla        AALYVLARRE-GLGMDVETFTGRIAEGGGGLDAAKEVVGD-LPRVAQARVRDQWDTERLR
                     **::*:         :  :*  *   ***: .*  .    :       :    : . **

1376|hp|hwa         DMFQALYLGSERYRELEDGEPPIDTQGYIIDEPVIIETETVDLLRETTKIGILTGRPAAE
2608|chp|nrc1       DVFQQLYLGTEYYRRFEGGDPDLAAPGFIHDEDRLLAPETGDALTADWPVCVLTGRPSDE
770|hp|nph          DVFQQLYLGSELYRELESGEPDLDTEGFIHDEPVLLAPDTREAL-EEWSLGVLTGRPAAE
328|gene|hut        EVFQQLYLGSDKYREIEGSEPTLSEAGYIHDETVLVDRSTLETLLANFEVGVLTGRPAAE
27640|gene|hbo      AAFQALYLGADLYRELEGSEPPFEASGYIHDEPIIVEGETLDYLTSNHRVGVLTGRPAAE
12106|hp|hma        DVFQTLYLGTDRYRDIEGGEPPFTAPGYIHDEPLLVDGETLSALQDRFAVGVVTGRPAAE
2596|gene|hhi       DVFQTLYLGTDLYRDIEGGEPPFDAPGYIHDEPLLVDDETLSALQARFAVGVVTGRPAAE
335|gene|hla        ETFQALYLGEELYRELEGGAPPLSAPGYIHDEPTLVEPETIADLTDRFDVGVLTGRPAAE
                      ** **** : ** :*.. * :   *:* **  ::  .*   *     : ::****: *

1376|hp|hwa         ASIALDRVQFSIPSSHQFTMDDWEEGKPHPRALQMLADRLEANTIVFVGDTLDDIKTAVN
2608|chp|nrc1       ADVALDRVGLDIPGERRFTMDDWAAGKPNPRALIALAERTGADSVVFVGDTLDDVATALN
770|hp|nph          AEIALDRVGLDIPETHRFTMDDWEEGKPHPHGLVELTKRFDAESAVFAGDTLDDIRTARN
328|gene|hut        ADIAMDRVGLDIPADHRFTMDDWDAGKPDPDALVTLAERFDADTVTFAGDTLDDVRTAVN
27640|gene|hbo      ADIALTRVRLAVPENHRFTMDDWEEGKPNPRALTTLADRLGAESVVFVGDTLDDVRTAVN
12106|hp|hma        ADIALERVGLDLPAEHRFTMDDWEEGKPHPAALQTLAERFDAERVAFAGDTLDDVATAVN
2596|gene|hhi       ADIALERVGLDLPTEHRFTMDDWEEGKPHPAALRTLAERFDAERVAFVGDTLDDVATAVN
335|gene|hla        AEIALERVGLDVPEDRRFTMDDWEEGKPHPRALVTLAERFDADRIAFIGDTLDDVRTARN
                    *.:*: ** : :*  ..******  *** * .*  *:.*  *:  .* ******: ** *

1376|hp|hwa         ANMADSSRTYHGVGVLTGGLSGDAGRDAFMSVGAHTVIDSVNDISDLVQ-----------
2608|chp|nrc1       AREADPGREYHAVGVLTGGLTGEAGRQKYHTAGADHVLDSVNDLPALLGQ----------
770|hp|nph          AAEDDPDREFYGVGVLTGGLSGDEGRRKFRNAGADIIIETINDLPGLLG-----------
328|gene|hut        AADTDSDRTYHGIGVLTGGLTSESGREKFEQAGADAVVESVNDLPELLEGGENRAGSQGA
27640|gene|hbo      AAEEDPEHTYHGVGVLTGGLTGDEGREKYESVGAAAVVGSVNDLPELLTDEG--------
12106|hp|hma        ADAADDDRVYYGIGVLTGGLTGDAGRQTFANNGASAVIESVTDLPELLDAV---------
2596|gene|hhi       ADEADDDRVYYGIGVLTGGLTGDAGRRTFANNGASAVVESVTDLPELLDAA---------
335|gene|hla        ADDEDASRVYYGIGVLTGGLTGDEGRRKFAENGADAVVEDVNELVELLE-----------
                    *   *  . ::.:*******:.: **  :   **  ::  :.::  *: