HOG Organism Gene ID Name Annotation
aHOG2161 hbo HBOR32380 Hbor_32380 hypothetical protein
aHOG2161 hla HLAC0996 Hlac_996 hypothetical protein
aHOG2161 nph NP6266 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


6266|hp|nph       MKACPETATLA---SVDDL--SGHLWVQELPTGGTFRFQVAASGLVTFAVGDRTFDSAES
32380|hp|hbo      MKNFPPLPAIEN--APDELLDGGHLWILELVDGEPLRFRLDESGLIRFGDETRVYDDSDA
996|hp|hla        MRSFPHLPDVRDSQAPDDLL-TGHLWLLELIDGTGLRFRMDESGLLRFGDPETTYADPET
                  *.  *  . :    : *:*   ****: **  *  :**.:  ***: *.    .: ..::

6266|hp|nph       VPIQYRRAAQLITNQIDRAALQAATSASSTVTFCGMTTWNEGLNYEWDVLPAFVGVDVW-
32380|hp|hbo      VPDRYQHAIRYIRENLDREVLRRAVTDVEDITFFGVATHHRTIEYDWERTPSFLGYDVW-
996|hp|hla        VPIALRPAVRHVRDRFDREALRDAVDDPEGVIFFGVATHYQGTDYDWDRLPPFLGTDVWI
                  **   . * . : :.:** .*. *.   . : * *::*.    :*:*:  *.*:* *** 

6266|hp|nph       --------SSSKETFLSPDAATGVFKRLGLPTLPAIEKEASAAHTDFARFDNDT-AFPES
32380|hp|hbo      --------SSDVDEFRPPDAAEQIFEQLGLRPANAVEKERNTRD-----FDPDSYTIPHS
996|hp|hla        ASQAGSQAASGTGSFRPPDAAAAIFEGVGLDSVNAVEREVNARD-----FDPEAYAIPDS
                          :*.   * .****  :*: :** .  *:*.* .:       ** :: ::* *

6266|hp|nph       AWRSGKAAGVLLRDKSDGHVTV----WQSECDES-PSATRGPSVTELADTYATNERIERT
32380|hp|hbo      AWYDGPTKGVVVRNKRGNRGKLSHPGFREKTNVE-PA---DGSAAELAAKFATPRRIETV
996|hp|hla        AWRDGPAAGVVVRNKRQGRGKLLAAGTATDAGETVPEVDVPDDIEAIVSEYATDDRFERV
                  ** .* : **::*:*  .. .:       . .   *      .   :.  :**  *:* .

6266|hp|nph       VELLEDDTATPTVASVRDRLIADIAREAYVELFTDGEFIVSFPEFRSVVAQRVQQHQSLS
32380|hp|hbo      ESRLSEHNRPVTFESVYERVLEAILREEHAR-LDQRANDLDMAAFRSELAAVIR--EDLD
996|hp|hla        VDDLDRRNAGATVDAVADRVVEAIARETPVR-FGEGSKGTAPDRVRAAIIERAR--VALD
                   . *.  .   *. :* :*::  * **  .  : :         .*: :    .    *.

6266|hp|nph       E-
32380|hp|hbo      G-
996|hp|hla        RR