HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0213COG0128arCOG041345-enolpyruvylshikimate-3-phosphate synthase3-phosphoshikimate 1-carboxyvinyltransferase

HOG Organism Gene ID Name Annotation
cHOG0213 nrc1 VNG1232 psc 3-phosphoshikimate 1-carboxyvinyltransferase
cHOG0213 hmu HMUK2641 Hmuk_2641 3-phosphoshikimate 1-carboxyvinyltransferase( EC:2.5.1.19 )
cHOG0213 hma RRNAC0127 aroA 3-phosphoshikimate 1-carboxyvinyltransferase
cHOG0213 hwa HQ3358A aroA 3-phosphoshikimate 1-carboxyvinyltransferase
cHOG0213 hla HLAC0687 Hlac_687 3-phosphoshikimate 1-carboxyvinyltransferase
cHOG0213 hbo HBOR19170 Hbor_19170 3-phosphoshikimate 1-carboxyvinyltransferase( EC:2.5.1.19 )
cHOG0213 hut HUTA0495 Huta_0495 3-phosphoshikimate 1-carboxyvinyltransferase
cHOG0213 hvo HVO_1308 HVO_1308 aroA 3-phosphoshikimate 1-carboxyvinyltransferase
cHOG0213 nph NP3078A aroA 3-phosphoshikimate 1-carboxyvinyltransferase
cHOG0213 hhi 877 aroA 3-phosphoshikimate 1-carboxyvinyltransferase
MUSCLE (3.6) multiple sequence alignment


1232|gene|nrc1      MPWAALLAGMHATVSPSRVRGRARAPPSKSYTHRALLAAGYADGETVVRDPLVSADTRAT
3078|gene|nph       ---------MDAHITPSTVNGTVRAPPSKSYTHRAILAAGYGDGAT-VKNPLFSADTRAT
3358|gene|hwa       ---------MDVSISRSRVRGRVRAPPSKSYTHRAILAAGYGDSAT-IIDPLISADTQAT
687|gene|hla        ---------MDVNVTSSTVRGTTRAPPSKSYTHRALLAAGYSDGAT-VRSPLVSADTKAT
10127|gene|hma      ---------MDITIAESTVEGTAQAPPSKSYTHRAVLAAGYADGAV-VHDPLVSADTKAT
877|gene|hhi        ---------MDITITESTVEGTAQAPPSKSYTHRAVLAAGYADGAV-VHDPLVSADTKAT
19170|gene|hbo      ---------MDVTISPSRIDGRTRAPPSKSYTHRAILAAGYGGQAT-VLNPLVSADTKAT
495|gene|hut        ---------MDVHVSPSTVTGQVQAPPSKSYTHRAILAAGYAEGAT-VRDPLESADTEAT
                             *   :: * : * ..***********:*****.   . : .** **** **

1232|gene|nrc1      ARAVELLGGAA-------ARENGDWVVTGFGSRPAIPDAVIDCANSGTTMRLVTAAAALA
3078|gene|nph       ARAVEAYGGTT-----EQADD--DLEVTGFDGTPGTPKDVINCANSGTTMRLTTATGALV
3358|gene|hwa       MRAIEAFGGTV------EHVDENHIEITGFNGRPRTPTDIINCENSGTTTRLVAACGALA
687|gene|hla        ARAVTAFGGAVEPESGERFDDADALVVDGFDGRPAVPDDVIDCANSGTTMRLVTAAAALA
10127|gene|hma      MRAVEAYGGSV-----SLAEDESTVEVTGFDGRPETPDDVIDCANSGTTMRLVTATAALQ
877|gene|hhi        MRAVEAYGGSV-----SLAEDESTVEVTGFDGRPETPDDVIDCANSGTTMRLVTATAALQ
19170|gene|hbo      MRAVDAFGGDT-----DLSADESSLSVSGFDGRPEVPADVVNCENSGTTMRLVTACAALG
495|gene|hut        MGAVEAYGGSV-----ERGVD--ALEVTGFDGRPAVPSDIVNCENSGTTMRLVTATAALA
                      *:   ** .         :     : **.. *  *  :::* ***** **.:* .** 

1232|gene|nrc1      DGTTVLTGDESLRARPHGPLLDALSGLGGTARSTRGNGQAPLVVDGPVSGGSVALPGDVS
3078|gene|nph       DGLAVLTGDESLRSRPQGPLLDALDQLGARAESTRENGQAPLVVGGDIDGGELAIRGDVS
3358|gene|hwa       DGLCVLTGDESLRSRPHGPLLEAIETLDGRGESTRRNGQAPLIVGDAFQGGSVAIPGDIS
687|gene|hla        DGTTVLTGDESLRSRPQGPLLEALGDLGVRAESTRGNGQAPLVVSGPLAGGEVAIPGNVS
10127|gene|hma      DDLAVLTGDESLRSRPQGPLLDAIGQLNGDAESTRHNGQAPLVVGGGIDGGAVEIPGDVS
877|gene|hhi        DGLAVLTGDESLRSRPQGPLLDAIEQLDGNAESTRRNGQAPLVVGGGIDGGGVEIPGDVS
19170|gene|hbo      DGLTVLTGDDSLRSRPQGPLLDAVTDLGGRGESTRRNGQAPLVVGDAMDGGTVSIPGDVS
495|gene|hut        DGITVLTGDDSLRSRPQGPLLDAIGQLDGRAESTRANGQAPLVVKGPVDGGTVSIPGDVS
                    *.  *****:***:**:****:*:  *.  . *** ******:* . . ** : : *::*

1232|gene|nrc1      SQFVTALLMAGAVTETGIETDLTTELKSAPYVDITLDVLDAFGVGASET-----------
3078|gene|nph       SQYITGLLMAGAVTESGIDIELTTALKSAPYVDITLEVLADFGVDAEVIG-GDDSEVRSA
3358|gene|hwa       SQYITALLMAGAVTVDGIDITLETELKSAPYVDITVELLSAFDVTVERT-----------
687|gene|hla        SQYVTALLMAGAVTEEGVEIDLTTPLKSAPYVDITLELLDDFGIEATPVGDGGDALDGAA
10127|gene|hma      SQYITALLMAGAVSPDGIDIDLTTELKSSPYVDITLEVLDAFGVDAEKT-----------
877|gene|hhi        SQYITALLMAGAVSPDGIDIDLTTELKSSPYVDITLEVLDAFDINAQKT-----------
19170|gene|hbo      SQYISALLMAGAVTDEGIDIELETELKSAPYVDITLELLDEFGVEAEQT-----------
495|gene|hut        SQYITALLMAGAITEEGIEIALETELKSAPYVDITIEVLDAFGVDVEST-----------
                    **:::.******::  *::  * * ***:******:::*  *.: .              

1232|gene|nrc1      -AAGYRVRGGQAYAPSGAEYAVPGDFSSASYLLAAGALAAADGAAVVVEGMHPSAQGDAA
3078|gene|nph       GADGFRVDGGQSYAPTDGTYHVPGDFSSMSYLLAAGALAADEE--VVVAGAHPSAQGDAA
3358|gene|hwa       -ADGFAVPGGQSYTPTDGTYVVPGDFSSISYLLAAGAVAATADGAVIIEGAHPSAQGDSA
687|gene|hla        GAAGFVVDGGQSYAPAGGSYTVPGDFSSISYLVAAGAVAAEPGEPVRIEGAVPSAQGDSA
10127|gene|hma      -DAGFTVDGGQTYVPDGGDYNVPGDFSSMSYLLAAGALAAEDG--LQVTSAFPSAQGDAA
877|gene|hhi        -DTGFTVEGGQSYTPAGGDYNVPGDFSSMSYLLAAGALAAEDG--LRVTSAFPSAQGDAA
19170|gene|hbo      -ADGFSVAGGQSYDPTGGEYEVPGDFSSISYLLAAGAIAAAEGESVVVEGARPSAQGDAA
495|gene|hut        -AAGFDVAGGQTYDPAGGEYAVPGDFSSISYLLATGALAAPDG--LTVTGARPSAQGDSA
                       *: * ***:* * .. * ******* ***:*:**:**     : : .  ******:*

1232|gene|nrc1      IVDVLERMGADIDWDTESGVITVQRSELSGVEVGVADTPDLLPTIAVLGAAADGTTRITD
3078|gene|nph       IVSILESMGADIEWNRDDGRITVRQSSLSGVEVGVADTPDLLPTIAVLGAAADGETRITD
3358|gene|hwa       IVEIIQSMGGQVAWDRNAGELTVPAASLTGITVDVGNMPDLLPTIATLGAIADGDTVINN
687|gene|hla        IVEIVERMGADIEWDREAGVITVRRSELSGVEVDVGDTPDLLPTIAALGAVADGDTRIMN
10127|gene|hma      IVDILDRMGADLDWDEEHGEITVSQSELTGIEVGVEDTPDLLPTIATLGAAADGVTRITD
877|gene|hhi        IVDILDRMGADLDWDEETGEITVTQSELTGIEVGVEDTPDLLPTIATLGAAADGVTRITD
19170|gene|hbo      IVDIVRDMGADVTWDRDAGELTVSRATLTGTTVDVGDTPDLLPTIATLGAVADGDTVIEN
495|gene|hut        IVDILERMGADISWDRDAGEITVSRSSLSGVEVSVADTPDLLPTISVLGAVADGDTRIVD
                    **.::  **.:: *: : * :**  : *:*  *.* : *******:.*** *** * * :

1232|gene|nrc1      AEHVRYKETDRVAAMAESLSKLGASVEERPDELVVRGGDTELSGASVDGRGDHRLVMALA
3078|gene|nph       CEHVRLKETDRVAAMATELERLGVETDEYEDELVVYGGGID--GGTVAGHDDHRIVMSLA
3358|gene|hwa       CEHVRYKETDRVSAMATELGAMGASVTEKHDQLTIHGGETTLSGTHVEGHGDHRIVMSLA
687|gene|hla        CEHVRYKETDRVSAMAEELEKLGAKTTEEPDTLTVHGSESDLRGASVDGRADHRIVMALA
10127|gene|hma      AEHVRYKETDRVSAMAEELTKMGAEVEEHQDELFVYGADSDLVGTTVEGRADHRIIMSLA
877|gene|hhi        AEHVRYKETDRVSAMAEELTKMGAEVEEHQDELFVYGADSDLVGTTVEGRADHRIIMSLA
19170|gene|hbo      CEHVRYKETDRVSAMADELGKMGASVTEEQDRLTIHGGETDLVGATVEGRHDHRIVMSLA
495|gene|hut        CEHVRYKETDRVAAMAEELTAMGASVTEEQEVLTIHGDDTDLSGAVVDGRADHRIVMSLA
                    .**** ******:*** .*  :*... *  : * : *      *  * *. ***::*:**

1232|gene|nrc1      VAGLVADGETTIAGSEHVDVSFPDFFEVLAGLGADTDG-----
3078|gene|nph       VAGLVADGEVTIKNADHVDVSFPSFFETLADLGVGVETGA---
3358|gene|hwa       IAALAAEGETTISDSEDVDVSFPSFFESLSALGASVQVDR---
687|gene|hla        VAALVAEGTTTIRGGEHVDVSFPNFFDAMADLGIAVERDGAGE
10127|gene|hma      VAGLVADGETTVTGAEHVDVSFPDFFDVLDSLGAAVEQ-----
877|gene|hhi        VAGLVADGETTVTGAEHVDVSFPDFFDVLDSLGAAVER-----
19170|gene|hbo      IAGLVAEGETTVTGAEHVDVSFPNFFDAIESLGVSVRRE----
495|gene|hut        VAGLVADGETIVQGGEHVDVSFPNFFDVIESIGASVQRE----
                    :*.*.*:* . : ..: ******.**: :  :*  .