HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0212COG2016KOG2523arCOG00985Predicted RNA-binding protein (contains PUA domain)hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0212 nrc1 VNG2646 vng2646 no entry
cHOG0212 hmu HMUK0427 Hmuk_0427 PUA domain containing protein
cHOG0212 hma RRNAC2087 PUA domain-containing protein
cHOG0212 hwa HQ3178A PUA domain-containing RNA-binding protein
cHOG0212 hla HLAC0035 Hlac_35 PUA domain containing protein
cHOG0212 hbo HBOR28020 Hbor_28020 RNA-binding protein, containing PUA domain
cHOG0212 hut HUTA0141 Huta_0141 PUA domain containing protein
cHOG0212 hvo HVO_0390 HVO_0390 conserved protein
cHOG0212 nph NP0340A hypothetical protein
cHOG0212 hhi 2580 HAH_2580 PUA domain-containing protein
MUSCLE (3.6) multiple sequence alignment


2646|chp|nrc1       MDVSSRHHLRSDDIDEIGDALRTGLGVELDGDAYERVTFADEEFEIVLVDGDPLVWYPDG
3178|gene|hwa       MQVKSRHHLRTDEIDTLTAEIEHTTGVALDADAYELVELDGVSYNVVLADDNLDIVRFDD
141|gene|hut        MNVKSRHHLRADAIDEIEDALAKGLGVELDAETYEKVTFEDSDWEVVLVEGAPAVFYVPD
340|hp|nph          MQVKSRHHLRSDEIDALEERLADRLGVTPDGDSYERVEFDDVDREVVLVDGEPLVASFDD
12087|gene|hma      MEVKSRHHLRSDEVDTITTALSENLGVELDADSFEKVEFDDSDWDVVLVDGDPLVLYLNG
2580|gene|hhi       MEVKSRHHLRSDEVDTITTALSENLGVELDADSFEKVEFDDSDWDVVLVDGDPLVLYLNG
35|gene|hla         MEVKSRHHLRSDDITAIREAVADHLGVDIDGDTFEFVEFVDANYELVLVDGEPAVFYVDD
28020|gene|hbo      MNVKSRHHLRSDEISELEEEIAAQTGVQMDGDAYEMVELADADFDVVLVDGDPVVVYMDD
390|hp|hvo          MKVKSRHHLRSDEIDALCDSIESSLGVALAGDAFEAVEFADADYEVVLVDGEPAVMYVDD
                    *.*.******:* :  :   :    **   .:::* * : . . ::**.:.   :    .

2646|chp|nrc1       -E-------PFVTVAGANRTDPSTGVVTVDAGAVSFVSDGADVMRPGITAASPEITAGDL
3178|gene|hwa       -E-------PFLTVQGANRYNPTRSVVTVDAGAISFVSNGADVMRPGIVDAETAIDAGDF
141|gene|hut        DESPDSTDDPFLTVRGANEYQPAQNVVTVDSGAISFVSDGADVMRPGIVEADESIDSGDL
340|hp|nph          -D-------LFLTVRGANEYAPDSHVVTVDSGAVSFVSDGANVMRPGITEATADIEPGDL
12087|gene|hma      -E-------PFLTVQGANQYPPEKHIVTVDAGAVSFVSDGADIMRPGITEADDDISADDL
2580|gene|hhi       -E-------PFLTVQGANQYPPEKHIVTVDAGAVSFVSDGADIMRPGITEADDDISEGDL
35|gene|hla         DE-------PFLTVRGANDYEPETGIVTVDAGAISFVSGGADVMRPGIVEADSAIREGDL
28020|gene|hbo      ER-------PFLTVAGANAYEPTKNVVTVDAGAISFVSDGADVMRPGIVDADDDIEPGDL
390|hp|hvo          -Q-------PFLTVKGANQFPPTTNVVTVDAGAVSFVSSGADVMRPGITEADESIEAGDL
                              *:** ***   *   :****:**:****.**::*****. *   *  .*:

2646|chp|nrc1       VVIQEAAHGKTLAVGRALVDGTEMDGESGKVVSSLHHVGDELFEFSV
3178|gene|hwa       VLIVEETHNKVLAIGRALVDGDELIGDSGKVVESIHHVGDDLYSFSV
141|gene|hut        LVISEENHGKVLAVGRARVDGSAMLGDEGKVVDTIHHVGDELYEFAG
340|hp|nph          VVIVEEAHGKALGVGRAEADGDDMVGDSGKVVETLHHVGDDLYEFHV
12087|gene|hma      VVINEESHGKFLAVGRAQTDGDDMVGDSGKVVKSLHHVGDDLFEFSV
2580|gene|hhi       VVINEESHGKFLAVGRAQTDGDDMVGDSGKVVKSLHHVGDDLFEFSV
35|gene|hla         VVIAEETHEKVLAVGRALVDGDNMVGDSGKVVESIHHVGDELYEFSG
28020|gene|hbo      VLIAEETHGKVLAVGRALEPGAEMVGDSGKVVESLHHVGDDLFEFAV
390|hp|hvo          VVIAEETHGKVLAVGRALEDGADLVGDSGKVVESIHHVGDDLFEFSV
                    ::* *  * * *.:***   *  : *:.****.::*****:*:.*