HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0211COG0150arCOG00639Phosphoribosylaminoimidazole (AIR) synthetasephosphoribosylformylglycinamidine cycloligase

HOG Organism Gene ID Name Annotation
cHOG0211 nrc1 VNG0876 purM phosphoribosylformylglycinamidine cycloligase
cHOG0211 hmu HMUK2746 Hmuk_2746 phosphoribosylformylglycinamidine cyclo-ligase( EC:6.3.3.1 )
cHOG0211 hma RRNAC0438 purM phosphoribosylaminoimidazole synthetase
cHOG0211 hwa HQ2665A purM phosphoribosylaminoimidazole synthetase
cHOG0211 hla HLAC0862 Hlac_862 phosphoribosylformylglycinamidine cyclo-ligase
cHOG0211 hbo HBOR16720 Hbor_16720 phosphoribosylformylglycinamidine cyclo-ligase( EC:6.3.3.1 )
cHOG0211 hut HUTA0433 Huta_0433 phosphoribosylformylglycinamidine cyclo-ligase
cHOG0211 hvo HVO_1557 HVO_1557 purM phosphoribosylformylglycinamidine cyclo-ligase
cHOG0211 nph NP3940A purM phosphoribosylaminoimidazole synthetase
cHOG0211 hhi 1195 purM phosphoribosylaminoimidazole synthetase
MUSCLE (3.6) multiple sequence alignment


876|gene|nrc1       --MTAGENADGDP-----------DGLTYADAGVDIADSEAATAALVDAASTGTDDTAYA
2665|gene|hwa       MSNPPDDTAERNTDIKTNASEEDSDELTYAAAGVDIEASEAATAALIDAVGESAGD--YA
862|gene|hla        --MTEGDGGETGGGDEEPTIDGD-DELTYADAGVDIDASEAATAALIGAVGEGEGD--YA
16720|gene|hbo      --MTDTDAGEGPADEADD------DELTYADAGVDIDASEAATAALVGAVGESEGD--YA
433|gene|hut        --MAEHEADDGDGASSSDATDEPDEELTYAASGVDIDESEAATEALLDAAGEFAGD--FA
3940|gene|nph       --MTEDDSEA--------------EGLTYAETGVDIEASEAATAALLGAVEDFEGD--YA
10438|gene|hma      --MTDSESEADDADSE--------EGLTYAETGVDIDASEAATKALIGAAGEFKGD--YA
1195|gene|hhi       --MTDGEPETDDTDEEDA------DGLTYAETGVDIDASEAATKALIGAAGEFEGD--YA
                       .  :                 : **** :****  ***** **:.*.    .*  :*

876|gene|nrc1       GLVDLGDQYLALATDGVGTKLLVAEAVGDYSTVGIDCIAMNVNDLLAAGVEPAAFVDYLA
2665|gene|hwa       GLIDIGDRYLALATDGVGTKLLVAAAMNEYSTIGIDCIAMNVNDLVAAGVRPVAFVDYLA
862|gene|hla        GLLDIGDRYLALATDGVGTKLLVAEALSDYSTVGIDCIAMNVNDLVAAGVRPVAFVDYLA
16720|gene|hbo      GLLDIGDRYLALATDGVGTKLIVAEALGDYSTVGIDCIAMNANDLVAAGVRPVAFVDYLA
433|gene|hut        GLVDIGDRYLALATDGVGTKLLVAEALDDYSTVGIDCIAMNVNDLVAAGIEPVAFVDYLA
3940|gene|nph       GLVDIGDRYLALATDGVGTKLLVAEALDDYSTIGIDCIAMNANDLIATGVTPVAFVDYLA
10438|gene|hma      GLVDIGDQYLALATDGVGTKLLVAEAVDDYSTIGIDCIAMNANDLIATGVEPVAFVDYLA
1195|gene|hhi       GLVDIGDQYLALATDGVGTKLLVAEAVDDYSTIGIDCIAMNANDLIATGVEPVAFVDYLA
                    **:*:**.*************:** *:.:***:********.***:*:*: *.*******

876|gene|nrc1       VDEPNERRAAELGDGLAAGADAAGVALVGGETAVMPDVVRGFDIAGTAAGVATDAELFPG
2665|gene|hwa       IDDPDENLTEQIGVGLDTGADIADITLIGGETAVLPEVVDGFDLAGTCAGLTPKDGVFTE
862|gene|hla        VDEPDERFAEQVGEGLARGAELADMELVGGETAVMPDVIRGLDLAGTCAGLAAKEAVFDG
16720|gene|hbo      VDEPDERFAEQVGEGLSVGAERADIELVGGETAVMPEVIKGLDLAGTCAGLADKDALFPG
433|gene|hut        IEAPDSTTTGQLGEGLQIGAELADIALIGGETAVMPDVIDGLDIAGTAAGLAPKDGLFAG
3940|gene|nph       VETPDDETAEQVGEGLSEGAERAEIALLGGETAVMPDVIRGLDLAGACVGLATEDELFDG
10438|gene|hma      VETPDEKTSEDIGAGLRTGAERADVALVGGETAVMPDVIKGLDIAGTCAGLAPKDAVFPG
1195|gene|hhi       VETPDEETSEDIGAGLRTGAERAGVALVGGETAVMPDVIKGLDIAGTCAGLAPKDAVFPG
                    :: *:.  : ::* **  **: * : *:******:*:*: *:*:**:..*:: .  :*  

876|gene|nrc1       RAEAGDALVGFPSAGIHSNGLTLAREAATRDGGYDEPYPYEGYETVGDALLEPTRIYTHL
2665|gene|hwa       TANPGDALVGFASSGIHSNGLTLARTAITREYEYTAPCPFDEYETLGAALLEPTRIYTDL
862|gene|hla        AAEPGDALVGWRSSGIHSNGLTLAREAATREHAYTDPCPFDGYETVGEALLEPTRIYTDL
16720|gene|hbo      EAESGDALVGFRSSGIHSNGLTLARTATTRDHEYTDDCPFEGYETIGEALLEPTRIYTNL
433|gene|hut        EAEPGDAIVGWPSSGIHSNGLTLAREAVTRDHDYDDPFPPEPSTTIGEELLAPTRIYTDL
3940|gene|nph       EAAAGDYLVGLPSSGIHSNGLTLAREAVTQRHDYTDPFPYDDDRTIGEVLLEPTRIYREV
10438|gene|hma      EAEAGDAIVGWPSSGIHSNGLTLAREAVTQDHEYTDPFPPNPDTTIAEALLTPTRIYSEV
1195|gene|hhi       EAEPGDAIVGWPSSGIHSNGLTLAREAVTRDHEYTDPFPPNPDRTIAEELLTPTRIYSEV
                     * .** :**  *:*********** * *.   *    * :   *:.  ** *****  :

876|gene|nrc1       LDAFREHGVHAAAHITGGGWTNLDRMGGFRYEVSDPLPAQPVFDYVQDAGGVSDAEMHRT
2665|gene|hwa       LDPMHAHDVRTAAHITGGGLRNLERLGSHRYVIDDPFETPPIFEFVQSAGNVSDSEMYQT
862|gene|hla        LDPMRDHGVRGAAHVTGGGWTNLTRLGANRYVVDDAFEPQPVFEFVQSEGSVSDEEMHRT
16720|gene|hbo      LDPMREHGVNAAAHVTGGGWTNLERMGDFHYVVEDAFDPHPVFEFVQSEGNVSDEEMHRT
433|gene|hut        LDPLREHGTHAAAHVTGGGWRNLTRMGPYRYEIEEPFDAQPIFEFVQTVGDVSDAEMHRT
3940|gene|nph       LGPLHAAETHAAAHVTGGGWTNLSRMGEYRYVIEDPFEPQPVFEFVQEEGSVDDEEMHRT
10438|gene|hma      LAPLRASETHAAAHVTGGGWTNLTRMGSYRYEITDPFEAQPVFEFVQAEGEVSDEEMHRT
1195|gene|hhi       LEPLRANETHAAAHVTGGGWTNLTRMGSHRYEITDPFEAQPVFEFVQAEGEVTDEEMHRT
                    * .:.   .. ***:****  ** *:*  .* : :.: . *:*::**  * * * **:.*

876|gene|nrc1       FNMGTGFVVALPEDAAAALASQT-DGEVVGRVADGD----GVSIRGLSL--
2665|gene|hwa       FNMGTGFVCAMSPKNAEMLAEAT-EGKIIGQVDTGE----GVSIRGLEL--
862|gene|hla        FNMGTGFVAAVDPDAAESLAAET-DGRVIGRVEEGDDDEGSVAIRGLEL--
16720|gene|hbo      FNMGTGFVAALAPDDAEALADAT-DGRVIGHVEDGS----GVSIRGLDL--
433|gene|hut        FNMGTGFVATFDPADAMNVVEETADGRIIGRVVDSDE---GVSIRGLDLQ-
3940|gene|nph       FNMGTGFVAALPADDAEAVVEELSDARIIGRVEDGD----AVEIRGLEL--
10438|gene|hma      FNMGTGFVAAVPEADAAEIVADSEDARVIGEVADGDE---AVAIRNLELTE
1195|gene|hhi       FNMGTGFVAAVPEADADEIVEKSEDARVIGTVADGDE---AVAIHGLELTD
                    ******** :.    *  :.    :. ::* *  ..    .* *..*.*