HOG Organism Gene ID Name Annotation
aHOG2108 hbo HBOR12320 Hbor_12320 hypothetical protein
aHOG2108 hbo HBOR33740 Hbor_33740 hypothetical protein
aHOG2108 hmu HMUK3400 Hmuk_3400 conserved hypothetical protein
aHOG2108 nph NP1864 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


33740|hp|hbo      ---MKQPR--ITPPRAIGLVTVIVSNLLPIVGVAAWDWNLSSLLVLYWVEGIGTVLFAAL
12320|hp|hbo      ---MAPPRHGDSLPPAFGFLPVLVANLPPLIGVLWLDWDPETLVAVYALELQLLFLLAGA
1864|hp|nph       MPSPGPPR-GTTRPLTFA--PMFLANLLPLVGVVWLDWSAETLVIIYVVEVLVVFPLAGL
                        **   : * ::.  .::::** *::**   **. .:*: :* :*    . :*. 

33740|hp|hbo      KALFAERASE---DSGRHHLPLQELCEKRGGVSPWSGGPPMYVRNVPHALGILLITGGIS
12320|hp|hbo      KALFAGQPPVSDRESGVISVSSNDLVAKRGSVSVHEFLPPIYPRNVPFAAAVIYGGAWFG
1864|hp|nph       KALFAQQPPKEDRESGVISVTESDLVDKHGSVTIHERLPPVYPRNLPFASNVIAFTVWVA
                  ***** ...    :**   :. .:*  *.*.*: ..  **:* **:*.*  ::     ..

33740|hp|hbo      ALIGGYIALRLSIDVSVVLSTSVAVGVLGLLVGRLTEFRFDYIDNEEYADISARMIAATP
12320|hp|hbo      LFISFSLSEVIAVS-DVIRHPAVLSSVAVLLIGQLGETGYSYIRSGRYADVSPYSVVEIP
1864|hp|nph       IFVGVAISGLGPLA-DAVHIPTVLVAVGGLLIGHVVELWREYFGQRRYEDVSPYAVVETP
                   ::.  ::   .:  ..:  .:*  .*  **:*.: *   .*: .  * *:*.  :.  *

33740|hp|hbo      ARQLILLLFLLPVAD-VGQEAG----PLLLFLIVTVKLLAETYSFYREHYRTEPGRFGQW
12320|hp|hbo      ARQGFFLMAVLFIVPFIAPVTGAAGTTLALVGFVFAKLLFEWSGFRAE--RDGGGRLTSW
1864|hp|nph       ARQAFLLMFLLIVLPQTQPTAG----TFVLGAFVFVKLLVDWSGFRAE--RGGGGRLTGW
                  *** ::*: :* :       :*    .: *  :* .*** :  .*  *  *   **:  *

33740|hp|hbo      VFGPRDTSE-----PPPEISVPDEPVSARLRTDTQSVLLSSVASIALGMANRIGYLALFL
12320|hp|hbo      LSGPDSDSA-----LEP-LDVPDDDPSAAIDVDRRAVAATAVWR---AVTTTGPFYATMA
1864|hp|nph       LSGPEPDAEASAAAPEP-PSVPDADPSEVVATSRRSAALAAASA---ALTKRAPFHVPYL
                  : **   :        *  .***   *  : .. .:.  ::.     .::.   : .   

33740|hp|hbo      VVMGILVFGW------------KSVAVGIVILGSIAAVRAAGHYLQYGTIEYQRRGDSLV
12320|hp|hbo      TFVWLGLIAI-VAGEPSPALRSGSAFIAFLLFCIMFCSDIVMGVLESGWVTYRRIGDQLV
1864|hp|nph       FVLWVLVSAFGLGGDASPLAALAVTGIIIGLFGVIVAGDVLEEILRHDAMEYRRCGDHLV
                   .: : : .               . : : ::  : .       *  . : *.* ** **

33740|hp|hbo      AYDTLLDEPQWKTTVEALDGIS-VENPISDRLLGTGTLSLSGVDSASRTAVKLGPVSDLE
12320|hp|hbo      AYDRLTGDTQWSAPVGVLHNATVVETQFSDRYFDTRRLTVKTGGDDDDTERTLGPVSNPE
1864|hp|nph       AYDTRLETPQWAAPVDTLRGVDLVCDRFADRYYGTRTVTVTTGWGDSETERLVGPVDDPE
                  ***     .** :.* .* .   *   ::**  .*  :::.   . . *   :***.: *

33740|hp|hbo      TAVEMFALPVTEPSRPEANHTVLAIAFVLAACFAAVPTTLFMLPDVETTNAIAVTIMLGP
12320|hp|hbo      ALIETFELPIRSTELSPLNQWLAGIAVASACLIVVAGATLLVTPFGPPAGWLYV------
1864|hp|nph       TLVAAFELPISDTDLTPFDRRVGAAVVAGAVLVVVAAAAMAFLPSVPPGGLFYL------
                  : :  * **: ... .  :. : . ... *  .... ::: . *   . . : :      

33740|hp|hbo      FFLLIVGVLVVSGLSRI---
12320|hp|hbo      LLLLPFLTAVPKGVWKLAHA
1864|hp|nph       FFLFPVVALTLRGVWRLGY-
                  ::*: . . .  *: .: