HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0210COG0252KOG0503arCOG01924L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit DL-asparaginase

HOG Organism Gene ID Name Annotation
cHOG0210 nrc1 VNG1844 ansA L-asparaginase
cHOG0210 hmu HMUK1652 Hmuk_1652 glutamyl-tRNA(Gln) amidotransferase, subunit D( EC:6.3.5.7 )
cHOG0210 hma RRNAC3442 asbA glutamyl-tRNA(Gln) amidotransferase subunit D
cHOG0210 hwa HQ2776A gatD glutamyl-tRNA(Gln) amidotransferase subunit D
cHOG0210 hla HLAC2140 Hlac_2140 glutamyl-tRNA(Gln) amidotransferase, subunit D
cHOG0210 hbo HBOR09030 Hbor_09030 glutamyl-tRNA(Gln) amidotransferase subunit D( EC:6.3.5.7 )
cHOG0210 hut HUTA3003 Huta_3003 glutamyl-tRNA(Gln) amidotransferase, subunit D
cHOG0210 hvo HVO_2511 HVO_2511 gatD glutamyl-tRNA(Gln) amidotransferase subunit D
cHOG0210 nph NP2492A gatD glutamyl-tRNA(Gln) amidotransferase subunit D
cHOG0210 hhi 669 gatD glutamyl-tRNA(Gln) amidotransferase subunit D
MUSCLE (3.6) multiple sequence alignment


1844|gene|nrc1      MTADPGDRVRVTHGDASHEGVLVPSPSDDHLVVKLDSGYNVGVDTADADIDVLDADAVTV
2776|gene|hwa       MSPHPGDRVRVERADVTNEGILMPSSTSDHLVIKLDGGYNVGIDRADASIDLVTSDAYDI
2492|gene|nph       --MNPGDRVRVDRADVTYEGVLMPSTTDEHLVVKLDGGYNVGIDRADADTEVLETDTYDV
3003|gene|hut       --MNPGDRVAVEDGERTFEGVLLPSTDTETLVVKLPSGYNVGVDREAAEADVLESDVYDI
13442|gene|hma      --MNAGDRVRVERAAQTYEGVLLPSSTPDHLVVKLDGGYNVGIDREDASIDVLESDVYDV
669|gene|hhi        --MNAGDRVRVERAAQTYEGVVLPSSTPDHLVVKLDGGYNVGIDREDASVDVLESDVYDV
2140|gene|hla       --MQPGDRVRVDRGDVTNEGVLLPSTTHDHLVVKLDGGYNVGIDRDEADVEVLESGARDV
9030|gene|hbo       --MNAGDRVRVERAGVTNEGVLMPSTTSDYLVVKLDGGYNVGIERDEADVDVLETDVYDI
                        .**** *  .  : **:::**.  : **:** .*****::   *. ::: :..  :

1844|gene|nrc1      DGDTGEDAAG----------------------STVEFDDDLPTIALISTGGTIASTVDYR
2776|gene|hwa       GGTQTDIGSSAGAGADTEADKTESDITSKSAASAVAFDESLPTVSLISTGGTIASTVDYR
2492|gene|nph       AEAQTA--EG---------------------TSEITFEDDLPTVSLISTGGTIASTVDYR
3003|gene|hut       EPGEAS--EE----------------------SKIEFDEDLPTISLISTGGTIASTVDYR
13442|gene|hma      ESAQDE--QS---------------------QSAIEFDDDLPTVSLISTGGTIASTVDYR
669|gene|hhi        ESAQDE--QS---------------------QSAIEFDDDLPTVSLISTGGTIASTVDYR
2140|gene|hla       DEGADAGGGE---------------------ASEITFDGDLPTISLISTGGTIASTVDYR
9030|gene|hbo       EEAQSE--ST---------------------TSEIAFDDDLPTVSLISTGGTIASTVDYR
                                                    * : *: .***::***************

1844|gene|nrc1      TGAVTAQFDAEDVLRAVPDLAGRANYRGRVVANILSENMEPSIWQDLAAAVREEIEAGAD
2776|gene|hwa       TGAVTAQFDAEDVLRAVPDLAGRANYRGRVVRNILSENMTPAVWQDLAAAVADEIRAGAD
2492|gene|nph       TGAVTAQFDAEDVLRAVPELAGRANYRGRVVANILSENMTPEVWQELAEAVREEIEAGAD
3003|gene|hut       TGAVTAQFDAEDVLRAVPELAGLANYRGRVVANILSENMTPDVWVDLAEAIHEEIEAGAD
13442|gene|hma      TGAVTAQFDAEDVLRAVPDLAGMANYRGRVVANILSENMTPAVWQDLAQAVHEEIENGAD
669|gene|hhi        TGAVTAQFDAEDVLRAVPDLAGMANYRGRVVANILSENMTPAVWQDLAQAVHEEIEAGAD
2140|gene|hla       TGAVTAQFDAEDVLRAVPDLAGRANYRGRVVANILSENMEPPIWQELAEAVREEIAAGAD
9030|gene|hbo       TGAVTAQFDAEDVLRAVPDLAGRANYRGRVVANILSENMTPDVWIDLAEAIEAEIEAGTD
                    ******************:*** ******** ******* * :* :** *:  **  *:*

1844|gene|nrc1      GVVVMHGTDTMQFSASALSFMLETPVPVVFTGSQRSADRPSSDNVMNAVCAVEAAKSDVA
2776|gene|hwa       GVVVMHGTDTMQYSASALSYMLDTPVPVVFTGSQRSADRPSSDNVMNAVCAVEAATADIS
2492|gene|nph       GVVVMHGTDTMQYTAAALSFMLDTPVPVVFTGSQRSADRPSSDNVMNAVCAVEAATADHS
3003|gene|hut       GVVVMHGTDTMQFSASAMAFMLETPVPIVFTGSQRSADRPSSDNVMNAVSAVEAAKSDAA
13442|gene|hma      GIVVMHGTDTMQYSASALSFMLDTPVPIVFTGSQRSADRPSSDNVMNAVSAVEAATSDCA
669|gene|hhi        GIVVMHGTDTMQYSASALSFMLDTPVPIVFTGSQRSADRPSSDNVMNAVSAVEAATSDCA
2140|gene|hla       GVVVMHGTDTMQYSASALSFMLDSPVPIVFTGSQRSADRPSSDNVMNAVCAVEAAKADHA
9030|gene|hbo       GIVVMHGTDTMQFTAAAMSFMLDTPVPIVFTGSQRSADRPSSDNVMNAVCAVEAAKADCA
                    *:**********::*:*:::**::***:*********************.*****.:* :

1844|gene|nrc1      EVMVCMHATESDDRCALHRGTRVRKTHTSRRDAFETVGATPLGYVDYDAASEAAT---AD
2776|gene|hwa       GVFVCMHASTADDTCALHRGTRVRKNHTSRRDAFKTVGATPIGKIEYDT-----------
2492|gene|nph       EVLVCMHATESDDNCALHRGTRVRKNHTSRRDAFETVGAEPLGNVDWET-----------
3003|gene|hut       EVMICMHATESDDACALHRGTRARKNHTSRRDAFETISRAPLGEVDYDS-----------
13442|gene|hma      EVLVCMHADESDDRCALHRGTRVRKNHTSRRDAFETVGAKPLGEVDYDIDGE--------
669|gene|hhi        EVLVCMHADESDDRCALHRGTRVRKNHTSRRDAFETVGAKPLGEVDYDIDGE--------
2140|gene|hla       ETLVCMHASQSDDACALHRGTRVRKNHTSRRDAFETVGGAPLGRIDYEAAAEAGADGDAA
9030|gene|hbo       EVLVCMHASESDDVCALHRGTRVRKNHTSRRDAFETVGAEPLGEIDYET-----------
                     .::****  :** ********.**.********:*:.  *:* ::::            

1844|gene|nrc1      ARGVTVEGAHAARGD------ATLDVASALEPAVELVKFTPGMNESLLA-ACEGS--AGV
2776|gene|hwa       -ETVSFHRDHAARES------TELNLTSELNEDVMLLTFTPGMNIDRQTAFLTDSTPDGL
2492|gene|nph       -GDVSFRRPVADRGD------ADPRLQGELNTDVELVTFVPGTDADRLA-VAEGA--DGL
3003|gene|hut       -RTVTFRREYAERGE------TDLALQDDLETDVDLVKFTPGAGPSMLD-PVEGA--AGV
13442|gene|hma      -STVTFHREYTERDA------VDLALHDNIETDVELLKFSPGMDPSLLEAAAEGS--EGI
669|gene|hhi        -STVTFHREYAERDA------VDLALHDDIETDVELLKFSPGMDPSLLEAAAEDS--EGV
2140|gene|hla       DAAIEWTRDPLPRGEDAGEDGASVDLEPDLDGDVELVKFTPGMDPAAWD-YLDSK--DGV
9030|gene|hbo       -EEITFRRDHAARGE------TEFSVRSDLSDDVDLLKFTPGMDLDAYADFLRGQDLDGL
                       :        *        .   :   :.  * *:.* ** .         .    *:

1844|gene|nrc1      VIEGTGLGHVHSDLTDTIGSLVDDGTTVVMTSQCLEGRVCDRVYDTGRDLLAAGVVEAGD
2776|gene|hwa       IIAGTGLGHVHTEFIPTVAELVADGVVVAMTSQCIEGRVCDRVYDTGRDLLEAGVVEAGD
2492|gene|nph       VIEGTGLGHVNTDWIARIDELTDDGTTVVMTSQCIEGRVCDRVYDTGRDLLDAGVIEAGD
3003|gene|hut       VIEGTGLGHVNTDWIDRIDALVEDGTAVVMTSQCIDGRVCDRVYDTGRDLLDAGVIEGED
13442|gene|hma      VIEGTGLGHVNTDWIGTIEEL---DIPMVMTSQCLEGRVCDRVYDTGRDLLDAGVIEGED
669|gene|hhi        VIEGTGLGHVNTDWIGTIENL---DIPLVMTSQCLEGRVCDRVYDTGRDLLDAGVIEGED
2140|gene|hla       VIEGTGLGHVHTDLIPRIEALIENGTVVAMTSQCLAGRVCDRVYDTGRDLLDAGVVEAGD
9030|gene|hbo       VVEGTGLGHVHTDFIPVLEELVESGTVVTMTTQCLEGRVCDRVYDTGRDLLEAGVVEAGD
                    :: *******:::    :  *   .  :.**:**: *************** ***:*. *

1844|gene|nrc1      TLPGTAKVKLMWALANADDPEAAMQESVAGALTTQSRPWTA
2776|gene|hwa       TLPGTAKVKLMWALANHPDPTNAMRKSLAGELQHRSVPWE-
2492|gene|nph       TLPATAYVKLMWALEHADSVAEAMQRPLAGELQERSTPWT-
3003|gene|hut       MLPGTAMVKLMWVLANRDDPAAAMGEPLAGEITERSTPWE-
13442|gene|hma      MLPGTAKVKLMWALANSDDVADTMQEPLAGEIQQRSTPWL-
669|gene|hhi        MLPGTAKVKLMWALANSDDVADAMQEPLAGEIQQRSTPWL-
2140|gene|hla       TLPGTAKVKLMWALANLSDPAEAMGRDLAGELTEESQPWR-
9030|gene|hbo       TLPGTAKVKLMWAVANLEDPEEAMQQSLSGELTQRSVPWE-
                     **.** *****.: :  .   :*   ::* :   * **