HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0021arCOG04610hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0021 nrc1 VNG1085 vng1085 no entry
tucHOG0021 hmu HMUK2536 Hmuk_2536 surface glycoprotein precursor
tucHOG0021 hmu HMUK2367 Hmuk_2367 putative transcriptional regulator, CopG family
tucHOG0021 hma RRNAC0836 csg2 surface glycoprotein precursor
tucHOG0021 hwa HQ1839A hypothetical protein
tucHOG0021 hwa HQ1871A hypothetical protein
tucHOG0021 hla HLAC1489 Hlac_1489 surface glycoprotein precursor
tucHOG0021 hla HLAC1330 Hlac_1330 hypothetical protein
tucHOG0021 hbo HBOR17610 Hbor_17610 hypothetical protein
tucHOG0021 hbo HBOR37350b Hbor_37350 hypothetical protein
tucHOG0021 hut HUTA2876 Huta_2876 surface glycoprotein precursor
tucHOG0021 hut HUTA1168 Huta_1168 putative transcriptional regulators, CopG/Arc/MetJ family
tucHOG0021 hvo HVO_1472 HVO_1472 surface glycoprotein precursor-related protein
tucHOG0021 nph NP1568A hypothetical protein
tucHOG0021 nph NP2720A hypothetical protein
tucHOG0021 hhi 1574 HAH_1574 hypothetical protein
tucHOG0021 hhi 1475 csg2 putative surface glycoprotein precursor
MUSCLE (3.6) multiple sequence alignment


1330|hp|hla         MPTFELNLSDDVYAEFQQLAEQ-EFVSEEQAAEDLIASGIEAYNVSIVDDE-PRDEMLDG
1839|hp|hwa         MPIVEVTLPDELLSEFEQLVEE-EFVTEEQAVEDLLTMGIDAYNVNIVDDSQPGDDIIEG
37350|hp|hbo        MPIVEVTLPDELLTEFEQLVDE-EFVTEEQAVEELLSMGIDAYNVSVVDESTPGDDFMDG
1085|hp|nrc1        MPTVEVNIPDQIEMQIAQLVEQGEFVSREEAIEQLLSSGIRAYKTSG-----PSED--E-
10836|gene|hma      MPKVEINIPEHLEMQIAQLVEKGEFLNREEAIEDLLSTGLKAYKTSG-----PQDE--D-
1475|gene|hhi       -------------MQIAQLVEKGEFLNREEAIEDLLSTGLKAYKTSG-----PQDE--D-
2876|gene|hut       MPEVEITIPDHLEMQIAQLVEEGEFLNREEAIEDLLSTGLKAYKTSG-----PIDD--E-
2720|hp|nph         MPKVQLTIPEHLEMQIAQLVEEGEFVNREEAIEELLSTGLRAYKTSG-----PMDD----
1489|gene|hla       MPQVEITVPEHLEMQIAQMVEQGEFLNREEAVEELLSTGIKAFKTSG-----PRDE--E-
1871|hp|hwa         MPNVDINVPEHLETQIAQLVDKDEFVDREEAIEELLSTGIRAFKTSG-----PMDD--E-
17610|hp|hbo        MPKVNISVPEHLEMQIAQLVEQGEFVSREEAIEELLSTGLRAFKTSG-----PMDE--D-
1168|chp|hut        MPKVSISLPDRIENDIERLVDQGEFVNRDQAVEELLTMGVSAYDTGEDEPEVAAED--DF
1568|hp|nph         MPEVEVSLPDRIDSEIARLVDQGEFLNREQAVEELLSMGVSAYAPSDSSDE-PADE--DI
1574|hp|hhi         -----------MDSDIQRLVEQGEFLNRDQAVEDLLKRGISAYNTTTEETE-TLDE--EI
                                  :: .:.:: **:  ::* *:*:  *: *:         . ::    

1330|hp|hla         AENNMFDTAQDPGSLEDD-------RL
1839|hp|hwa         AENNLFDTATDPGGLEDD-------RL
37350|hp|hbo        AENNLFDTASDPGGINDD-------RL
1085|hp|nrc1        -DGAGLE--SEGGMMGHD----DEYVF
10836|gene|hma      -EEPGFE---EDGMMGHD----DEYVF
1475|gene|hhi       -EEPGFE---EDGMMGHD----DEYVF
2876|gene|hut       -EDPGLE---EDGMMGHD----DEYVF
2720|hp|nph         -EDPGLE---EDGMMGHD----DEYVF
1489|gene|hla       -DSGGFE---DEGMMGHE----DEYVF
1871|hp|hwa         -DR--FE---DDGMMGHE----DEYVF
17610|hp|hbo        -DR--FE---DDGMMGHE----DEYVF
1168|chp|hut        FSQTVED--QQDPALHDDDPD-DGYTF
1568|hp|nph         FTQMTDD--QQDPAAREDDPQGDEYTF
1574|hp|hhi         FDQTASE--QQDPAMQDD-------FL
                          :   :      :        :