HOG Organism Gene ID Name Annotation
aHOG2078 hla HLAC1614 Hlac_1614 Conserved TM helix repeat-containing protein
aHOG2078 hmu HMUK1346 Hmuk_1346 hypothetical protein
aHOG2078 hut HUTA0220 Huta_0220 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1614|chp|hla      MDIMG-----FTDPLMLQIDVPGEPRYLQESIADIIAFLPRLIGAVVILLVGWIIGRLVA
220|hp|hut        MVATGSFDQFVTAPLFVDSFVAS----WESAIKSFIAELPGIVGALVILLVGVFLGRRIG
                  *   *     .* **:::  *..     :.:* .:** ** ::**:****** ::** :.

1614|chp|hla      GAVRRIVDRTEVDRLVMNTPLGGALGGSERAISRSLGRAAGYFVYALAILTAADALDVEL
220|hp|hut        SIAHELVGRAGLDEWFADSPIAPLL-GEDGSFAGAVGLVVKYYVVLFALLVAIRFVGFAI
                  . .. :*.*: :*  . ::*:.  * *.: ::: ::* .. *:*  :*:*.*   :.. :

1614|chp|hla      LSEWIAAAVSYLPAFIAGVLIIVIGFVLADFVADIAAHTETVTETSYTDVFADGLRVFLY
220|hp|hut        LEQWVQTLVVYLPRALAGAAIIMFGVVFAEYAGRQAAGSEAVQQSEYGPWVTAGVKAIVY
                  *.:*: : * ***  :**. **::*.*:*::..  ** :*:* ::.*   .: *:..::*

1614|chp|hla      FVVTVIGLGTMGVDVQI----LNTFAQAAAWGLAAGIALAIGIAFGLGGRDYVATNIGDW
220|hp|hut        FVVAVIGLDMLGMNLEIVYLVVDGVASAIGLGITAAIALAVGVAVGFAAKEYAEGGLGD-
                  ***:****. :*::::*    :: .*.* . *::*.****:*:*.*:...:*.  .:** 

1614|chp|hla      LPGRAPDPESTPMGQPDGGEESTD
220|hp|hut        --------------NSGSAEE---
                                :....**