HOG Organism Gene ID Name Annotation
aHOG2045 hbo HBOR17480 Hbor_17480 protein of unknown function (DUF839)
aHOG2045 hla HLAC0983 Hlac_983 protein of unknown function DUF839
aHOG2045 hmu HMUK0696 Hmuk_0696 protein of unknown function DUF839
aHOG2045 hma Hma_10761 hypothetical protein
aHOG2045 hma Hma_10766 putative cell surface protein
MUSCLE (3.6) multiple sequence alignment


983|gene|hla        MPNNYTRRTVVSSLAALAAASQTAGSVAGKE-AEGQGHGIEQEGATLNRFATTIIGAEIT
17480|hp|hbo        -MVEFTRRKLMATSVAAALGASVAGTAAAE---DGDTPHAPMVKGELTRFATTAFGAEVT
10761|hp|hma        -MVDFSRRQVLSKSVAAALGASVIGVASGDEVAESETVGSGTVKGDLKRFSTTAFGAEVT
10766|gene|hma      -MVDFTRRQVLSQSVAAALGASVIGVASGEEVEETDTPGAPSVAGSLKRFSTTAFGAEVT
                       :::** :::  .* * .:.. * .:..   : :        . *.**:** :***:*

983|gene|hla        GMFITEDGRFFFNVQHPDANLDGEDEPGILGAVTGVDMNQLPRDFQSVQIPEGDDDDYSD
17480|hp|hbo        GPFVTQSGTLIFSLQHPSRQNPAPFNTGGIGYVKGFSF--------------GDDDDVQE
10761|hp|hma        GPFVFQNGALLYSLQHPEEENPEPFDTAGIGYFSGFQFEL-----------DGTNDDFDE
10766|gene|hma      GPFVFEDGSLLYSLQHPEGENPEPFGRAAVGYFSGFQFEF-----------DGSNDDFSE
                    * *: :.* :::.:***. :       . :* ..*..:              * :** .:

983|gene|hla        DGDGVPEPYDQRVRTALGDYQRLATGGDETDDGEE-LGSVYTPEGDSLT---------GQ
17480|hp|hbo        IGIPNTKEKQSKVRVGNGEYVLLAQEGDNIGDDED-LGIPTTPDGVNIS--QFDGTRYSD
10761|hp|hma        LSTPQTEAEQRQVRSGDGEYEILAHGRDKINDGEERLGVTQTPDGTDITLDNFEGTQYGA
10766|gene|hma      VGIPDTEEKQRQVRSAAGDYEVLIQGREEIQGGEERLGVPQTPDGVDLT--ALNGSS-GG
                     .   .:  : .** . *:*  *    ::  ..*: **   **:* .::         . 

983|gene|hla        I--NPDFNGYVPSSEEPDEGYLFTNWEHRPGAMTRVHLQQNGRNGTWRV-------LGME
17480|hp|hbo        FGYTPDMNQFVPTNEDGTKGVLFTNFEASPGNVTRMPIEQD-EDGGWTADR--ENTTNLA
10761|hp|hma        AGTNPDCNQFVPTDEDGTEGYLFTNWENSPGNVSRIPLRQT-FDGEWEADL--DDAINLA
10766|gene|hma      YGQNPDCNQFVATDDEGTEGYLFTNWENYPGCISRVPISQD-ESGEWSADVGSDMTLNVV
                       .** * :*.:.::  :* ****:*  ** ::*: : *   .* * .        .: 

983|gene|hla        NLD-FSAVEGTWVNCFGTVSPWGTPLTSEENYSIPDTPV---------------------
17480|hp|hbo        NTEAMRELGGTRINCYGDRSPWGTPLSAEEEYAHPRLAGTATTSDIMDAGSGVGYRGASQ
10761|hp|hma        NTEPFREIGGTRINCYGDLSPWGTMISSEENYAHPRVSLTNQVGDIVDAGTGKGRIGGAQ
10766|gene|hma      NTEPFRDIGGTWVNCYGDLSPWETMISAEENYSHPRVSYTHTVGDIVESGTGVGKIGGCQ
                    * : :  : **.:**:*  *** * :::**:*: *  .                      

983|gene|hla        -WNNPD--------------------WQYKG-----GVERLARHLGHER-------NDDG
17480|hp|hbo        FWNRPNPTEVGSS--EWY--DEYNDGVYPQGAFALAGLELHAYYLGADPV------GDET
10761|hp|hma        FWNRPNPTEIQSAVDDYY--G--DEAWSIQGYWALDGVEFLAYYLGSEQSYQNSNSNSTE
10766|gene|hma      FWNRPNPSEIGEALGDYVEAGDIEEEFTIQGYWSQAGVEKAAYYLGADTVDQTEDGNDMT
                     **.*:                       :*     *:*  * :** :        ..  

983|gene|hla        IFADKFPNPYRYGYIVELKEPESEEPIPEKRFALGRSTHENAVVMPDEKTAYTTSDGTAR
17480|hp|hbo        PIGDTYPNVYRTGYIVDFRKPEWAEPKPVKYYVFGRAAWEAPDVQSDEKTVYLTSDGDTK
10761|hp|hma        PISDTYPNPYRYGYHVDFREPTADPPQPVKYYVMGRASWEAPNIQADEQTVYMCSDGDSK
10766|gene|hma      LIDDVYPNPYRYGYFVDIREPAAETPSPMKYYVMGRAAWEAPDIQGDQRTVYGCSDGDSK
                     : * :** ** ** *::.:*    * * * :.:**::.* . :  *:.*.*  *** :.

983|gene|hla        GFYKFVADEK------GDLSSGTLYAAKATQKGPLGGD------PDKVSFGIEWIELGHA
17480|hp|hbo        GLYKFVADEPIPSYDDPMDVAGTLYAAKVTNE-----DAAKNKPPANVDLELDWLPLSHA
10761|hp|hma        GIYKFVADERIPKYDDPMDVSGTLYAPKITNPQADASTVGTRKSPAEYSLDIEWIPLGSA
10766|gene|hma      GIYKFVADEPIPEYDNTDDIAGTLYAPKITNDAANAAEAGQRNSPAQTPLEIEWMELGHA
                    *:*******           :*****.* *:             * :  : ::*: *. *

983|gene|hla        SDEEIEKWIAEYDDITQADYE--------------------------------DGENSYI
17480|hp|hbo        TNREVASWIAEYDDVTQVDYLETHAETDWQE-----DFEAALAEADKAVAK--NGNQDFI
10761|hp|hma        SNAEIEEWIAEYDDITQSDYLRVHAGSDWME-----DREAALEEADREVIE--NGNQNYI
10766|gene|hma      TNGEAAEWIAEYDDVTQADYITEHTEYSVDEIGTDVSVSDAVREADLTVLQSASGNQSYI
                    :: *  .*******:** **                                 .*::.:*

983|gene|hla        SEGEMDEWAAG-----------DADDDRVAFLQCRQAAMRKGATTEFRKMEGINIRRGAE
17480|hp|hbo        TDEEIQAWANKW-TDDPNAVVDDESLRKVPFLETRAAAKAIGATVEFRKSEGIDSVEDAQ
10761|hp|hma        TNEEIVEWADQYYAEGPDGV--DEELRRVPFLETRAAAKEVGVSIEFNKAEGVDSKDGAG
10766|gene|hma      TNEDIVEWAEQYEANGPDGV--DEELRRIPFLETRAAAKEIGATIEFNKAEGVDTVDNSQ
                    :: ::  **             * .  .:.**: * **   *.: **.* **::   .: 

983|gene|hla        AGEDYMYVAMSNTNRTMGDDEGDIQLNGDEWGAVYRMPLESDYDISEMEPIVTGGPEANI
17480|hp|hbo        PG-DYIYLGISELNGGMSDQHGDLRMDRVDGGLVYRAEIEADYNISTLEPVIVG------
10761|hp|hma        PG-DPVYFGISEFNDDLANDEGDIQMDRVDGGVVYRGVLESDYNISTLEPVIVG------
10766|gene|hma      PG-DFIYFGISEFNDDLANDTGDIQMDRVDGGVVYRGVLESDYNVSTLEPVITG------
                    .* * :*..:*: *  :.:: **:.::  : * ***  :*:**::* :**::.*      

983|gene|hla        CGGCPYDANPNANDKACQSCAFNPTKDDEDQGRLKGTMNLAKSMAMSGQTSLDVENTIAE
17480|hp|hbo        ---------SDASDPAD-----------------------------------VANDSVLN
10761|hp|hma        ---------PDFTDEPE-----------------------------------DADDALRN
10766|gene|hma      ---------PDFTDEPE-----------------------------------DANDALRN
                             .: .* .                                     .:::: :

983|gene|hla        PDNIVVMDDGRVVIGEDT-----GNRGHENNMIWVFDP----------------------
17480|hp|hbo        IDNVFVMDDGRVLCCEDADKFG---RSYPNDCMYLYTP----------------------
10761|hp|hma        VDNVYVMDDGRVLCCEDG--FGGPARSYPNDGLYVYEP----------------------
10766|gene|hma      IDNVYTMRDGRVLCCEDG--FGGPARSYPNDGLYVYQPTVTVSANSAAVGSGSTGTVSLT
                     **: .* ****:  **        *.: *: :::: *                      

983|gene|hla        ------------------------------------------------------------
17480|hp|hbo        -----------------------DELG---------------------------------
10761|hp|hma        -----------------QEPEEKTRNG---------------------------------
10766|gene|hma      ASSLPAGFSGARLTVNVSNPEIASITGVSFPDALGLTESSVSDDGSSATIRVADVNTNVQ
                                                                                

983|gene|hla        -------------------------------------------------------GSA--
17480|hp|hbo        --------------AIGDG--------------DRNN------------------GHGND
10761|hp|hma        --------------NSGNGNSG-----------NGNN------------------GNENS
10766|gene|hma      SGARDVSLATLDVRANGGGTTDLTVSIEQMDDENGNAIEAEARNGIVVGGPQTVVGDAAP
                                                                           *    

983|gene|hla        ------------------------------------------------------------
17480|hp|hbo        ADGDDEGN----PGNSE-------------------------------------------
10761|hp|hma        NNGNENGH----SGNGSNS-----------------------------------------
10766|gene|hma      TDPDGDGHFEDLNGNGRLDYEDVQVLFSNMDSDSVQLNTGAYDFNENGKLDFADVTALYE
                                                                                

983|gene|hla        ---
17480|hp|hbo        ---
10761|hp|hma        ---
10766|gene|hma      EVN