HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0204COG0533 COG3642KOG2708 KOG2707 KOG3087O-sialoglycoprotein endopeptidase homolog

HOG Organism Gene ID Name Annotation
cHOG0204 nrc1 VNG2045 gcp O-sialoglycoprotein endopeptidase homolog
cHOG0204 hmu HMUK1173 Hmuk_1173 metalloendopeptidase, glycoprotease family( EC:3.4.24.57 )
cHOG0204 hma RRNAC2490 gcp O-sialoglycoprotein endopeptidase/protein kinase
cHOG0204 hwa HQ1341A gcp O-sialoglycoprotein endopeptidase/protein kinase
cHOG0204 hla HLAC2392 Hlac_2392 metalloendopeptidase, glycoprotease family
cHOG0204 hbo HBOR05000 Hbor_05000 O-sialoglycoprotein endopeptidase( EC:3.4.24.57 )
cHOG0204 hut HUTA1954 Huta_1954 metalloendopeptidase, glycoprotease family
cHOG0204 hvo HVO_1895 HVO_1895 peptidase M22 family protein with serine/threonine protein k
cHOG0204 nph NP5070A O-sialoglycoprotein endopeptidase/protein kinase
cHOG0204 hhi 2922 gcp O-sialoglycoprotein endopeptidase/protein kinase
MUSCLE (3.6) multiple sequence alignment


2392|gene|hla       -MRVLGIEGTAWCASAALYDAET-------DSVLIESNPYEPDSGGIHPREAAEHMSEAI
5070|gene|nph       MTRVLGIEGTAWCASAAVFDAET-------DAVFIDSDAYVPESGGIHPREAAEHMREAV
1341|gene|hwa       -MRILGIEGTAWAASAALYNTHD-------ETIVIESDPYQPDSGGLHPREAAEHMSTAL
2045|gene|nrc1      -MR------------------------------------------------------EAI
5000|gene|hbo       -MRIVGIEGTAWAASAALFDTAT-------DEVFIESDPYEPDSGGIHPREAAEHMGDAI
1954|gene|hut       -MRILGIEGTAWAASAAVYERTDSG-----ESVVIETDAYEPDSGGIHPREAAEHMREAI
12490|gene|hma      -MRILGIEGTAWAASASVFETPDPARVTDDDHVFIETDAYAPDSGGIHPREAAEHMGEAI
2922|gene|hhi       -MRILGIEGTAWAASAAVFETPDPAQVTDDDHVFIETDAYAPDSGGIHPREAAEHMGEAI
                      *                                                       *:

2392|gene|hla       PEVVDAVLTTAEAE--------HGPD--AIDAVAFSRGPGLGPCLRIVGTAARSLAGTLD
5070|gene|nph       PSVVEAALDHVESN--------WGDPADAIDAVAFSRGPGLGPCLRIAGTAARSLAGTLS
1341|gene|hwa       PEVISTILERAVSS--------GNTDAIGIDAIAFSRGPGLGPCLRVVGTAARTLTQALS
2045|gene|nrc1      PAVIETVLGAA-----------DG----DIDAVAFSRGPGLGPCLRIVGSAARALAQALD
5000|gene|hbo       PAVVSTVLDHAVETA-------EG-DSPEIDGVAFSRGPGLGPCLRIVGTAARSLAQTLD
1954|gene|hut       PQVVERALDIAREQAADAG---EDPDESPVDAVAFSRGPGLGPCLRIVATAARALAQRLD
12490|gene|hma      PTVVETAIEHTHGRA---GR--DGDDSAPIDAVAFARGPGLGPCLRIVATAARAVAQRFD
2922|gene|hhi       PTVVETAIGHAHERAAAGGTNGDGDDSAPIDAVAFARGPGLGPCLRIVATAARAVAQRFD
                    * *:.  :  .            .     :*.:**:**********:..:***:::  :.

2392|gene|hla       VPLVGVNHMVAHLEIGRHQSGFENPVCLNTSGANAHLLGYHDGRYRVLGETMDAGVGNAI
5070|gene|nph       CPLVGVNHMVAHLEIGRHRSGFESPVCLNASGANAHVLGYHNGRYRVLGETMDTGVGNAI
1341|gene|hwa       VPLIGVNHMIAHLEIGRHQSGFTTPVCLNASGANAHLLGYHRRQYQVLGETMDTGVGNAI
2045|gene|nrc1      VPLVGVNHMVAHLEIGRHQSGFQQPVCLNASGANAHVLAYRNGRYRVLGETMDTGVGNAI
5000|gene|hbo       VPLVGVNHMVAHLEIGRYQSGFDSPVCLNASGANAHLLGYHNGRYRVLGETMDTGVGNAI
1954|gene|hut       VPLVGVNHMVAHLEIGRHRSGFSAPVCLNASGANAHILGYRNGRYRVLGETMDTGVGNAI
12490|gene|hma      VPLVGVNHMVAHLEVGRHRSGFDSPVCLNASGANAHILGYRNGRYRVLGETMDTGVGNAI
2922|gene|hhi       VPLVGVNHMVAHLEVGRHRSGFDSPVCLNASGANAHILGYRNGRYRVLGETMDTGVGNAI
                     **:*****:****:**:.***  *****:******:*.*.  .*.*******:******

2392|gene|hla       DKFTRHVGWDHPGGPKVEAAARRYAEGNDGPEDLLDLPYVVKGMDFSFSGISSAANDAYD
5070|gene|nph       DKFTRHVGWSHPGGPKVESHAE------DG--DYVELPYVVKGMDFSFSGIMSAAKQAYD
1341|gene|hwa       DKFTRHLGWNHPGGPKVEAAAT------DG--SYHDLPYVVKGMDFSFSGIMSAAKDAVD
2045|gene|nrc1      DKFTRHVGWQHPGGPKVETHAR------DG--EYTALPYVVKGMDFSFSGIMSAAKDAVD
5000|gene|hbo       DKFTRHVGWTHPGGPKVERAAK------DG--EYHDLPYVVKGMDFSFSGIMSAAKQASD
1954|gene|hut       DKFTRHLGWSHPGGPKVEKRAK------DG--EYIDLPYVVKGMDFSFSGIMSAAKQAID
12490|gene|hma      DKFTRHIGWSHPGGPKVEQHAR------DG--EYHELPYVVKGMDFSFSGIMSAAKQAVD
2922|gene|hhi       DKFTRHIGWSHPGGPKVEQHAR------DG--EYHELPYVVKGMDFSFSGIMSAAKQAVD
                    ******:** ********  *       **  .   *************** ***::* *

2392|gene|hla       DGVPVEEICFSLQEHVFAMLTEVSERALSLTGADELVLGGGVAQNDRLREMLASMCAARG
5070|gene|nph       DGTPVADVCCGLQETIFAMLAEVSERALSLTGADELVVGGGVAQNSRLQEMLTQMCENRG
1341|gene|hwa       NEVPVVDVCTGLQETIFAMLTEVAERALSLTGSNELVLGGGVGQNDRLREMLSTMCTARG
2045|gene|nrc1      DGVPVADVCRGLEETMFAMLTEVAERALALTGRDELVLGGGVGQNDRLRGMLEAMCAARG
5000|gene|hbo       DGVPVEDVCCGLQETIFAMLTEVAERALSLTGTDELVLGGGVGQNARLREMLSEMCDQRG
1954|gene|hut       DGEAVEDVCYSLQENIFAMLTEVAERALSLTDADELVLGGGVGQNERLREMLGKMCDQRG
12490|gene|hma      DGVPVENVCRGMEETIFAMLTEVSERALSLTGADELVLGGGVGQNARLQRMLGEMCEQRE
2922|gene|hhi       DGVPVDDVCRGMEETIFAMLTEVSERALSLTGADELVLGGGVGQNDRLQRMLGEMCEQRG
                    :  .* ::* .::* :****:**:****:**. :***:****.** **. **  **  * 

2392|gene|hla       ARFHAPDSRFLRDNAGMIAVLGAKMAQAGDTVPISESAIDPNFRPDQVPVTWR-SGESVA
5070|gene|nph       AAIYVPEPRFLRDNAGMIAVLGAKMYEAGDIISIPESGVRPDFRPDEVPVSWR-DDEAVA
1341|gene|hwa       ASFYAPESRFLRDNAGMIAVLGAAMYEAGQTISVNDSAVDPTFRPDAVTVTWRDDETSVT
2045|gene|nrc1      ASFHAPEPRFLRDNAGMIAVLGAKMAAAGATIPVADSAINSQFRPDEVSVTWR-DPESPA
5000|gene|hbo       ADFYAPEPRFLRDNAGMIAVLGARMLAAGDVLPISDSAVNPNYRPDQVPVTWRDDEESVA
1954|gene|hut       ADFYAPEPRFLRDNAGMIAVLGAKMYDAGDTIPIEDSRVRPDFRPDEVDVTWR-SDEAVG
12490|gene|hma      AEFYAPENRFLRDNAGMIAMLGAKMYAAGDTIAIEDSRIDSNFRPDEVAVTWRGPEESVD
2922|gene|hhi       ATFYAPEHRFLRDNAGMIAMLGAKMYAAGDTIAIEDSQIDSNFRPDEVAVTWRGTEESVD
                    * ::.*: ***********:*** *  **  :.: :* : . :*** * *:**    :  

2392|gene|hla       RG------------RAPGSDDKTDADRRGAEATVEIVPSGEPDAADRRVIKRRVPKEYRH
5070|gene|nph       RP--------------VPTDER----RQGAEAVVDIDADGG------RVTKRRLEKAYRH
1341|gene|hwa       RT--------------PATLDKTP--VRGAEAIVRRIND--------HVVKRRVEKSYRH
2045|gene|nrc1      RD--------------PGADAV----RQGAEATVTFADD--------AVIKERAPKAYRH
5000|gene|hbo       RD--------------PTAEGK----IRGAEATVTFEDD--------SVVKRRVPKTYRH
1954|gene|hut       SWGGSSDDGTVGARDGAGADDA----VQGAEATVTVEDG--------RVRKERQPRTYRH
12490|gene|hma      SY--------------RMGGDE----VQGAEATVHFDGD--------RVIKVRVPRSYRH
2922|gene|hhi       SY--------------RAADDE----VQGAEATVRFDGD--------RVIKERVPRSYRH
                                               .**** *    .         * * *  . ***

2392|gene|hla       PGLDRTLRRDRTVAEARLTSEARQAGVTTPLVYDADVPNATLTLQYVGDRDLAAALDGGT
5070|gene|nph       PVLDSRLRSQRTRSEARLTSEARRQGVPTPVVYDVDPDAGRLVFQYVGDADLKTALS--E
1341|gene|hwa       PKLDRRLRAERTRAEARLTSAARRLGVPTPLIFDADPETGTLVFEYVGETDLAADLT--V
2045|gene|nrc1      DRLDDRLRRDRTVLEARLTSDARRQGVPTPLVRDVDVPAATITLQHVGDADLRDALS--P
5000|gene|hbo       AELDDKLRKERTRAEARLTSQARREGVPTPVIRDVDPTEGVIVFESVGKSDLAGALT--T
1954|gene|hut       PTLDERLRTERTREEARLTSEARRVGVPTPVVHDVDPQEGVLVFERVGERDLREALT--L
12490|gene|hma      PTLDERLRTERTRQEARLTSEARRNGVPTPLVRDVDPQESRIVFQRVGDTDLREGLS--E
2922|gene|hhi       PTLDERLRIERTRQEARLTSEARRNGVPTPLVRDVDPQESRIVFQRVGDADLREGLS--E
                      **  ** :**  ****** **. **.**:: *.*   . :.:: **. **   *    

2392|gene|hla       ERVAAVGRYLARLHDAGIVHGDPTTRNVRVGVGDSDTQTGDGEANGTTAVDDRTALIDFG
5070|gene|nph       SAVRDVGRHLAACHAAGFVHGDPTPRNVRVG-------------------EDRAFLIDFG
1341|gene|hwa       SRCHAVGQHLGRIHNAGFVHGDPTTRNVRVD-------------------SAQNYLIDFG
2045|gene|nrc1      ARVRAVGRHLATIHDGGFVHGDPTTRNVRVG-------------------AERTFLIDFG
5000|gene|hbo       ERCRTVGKHLATVHDAGFVHGDPTTRNVRVD-------------------AEKTYLIDFG
1954|gene|hut       DRVRDVGRHLATIHDAGFVHGDPTTRNVRVS-------------------EDRTHLIDFG
12490|gene|hma      GRVADVGRWLARIHDAGFVHGDPTTRNVRVG--------------GRDEQADRTTLIDFG
2922|gene|hhi       SRVTDVGRWLARIHDAGFVHGDPTTRNVRVG--------------GRDEQADQTFLIDFG
                         **. *.  * .*:******.*****.                     .  *****

2392|gene|hla       LAYHTGHVEDHAMDLHVFEGSVRATAIDPDPLIEAFEDGYATVGDDD---------VLDR
5070|gene|nph       LGYYTDAVEDYAMDLHVFEGALGGTADDPTAQITAFEDAYRSAGDGA---------VVDH
1341|gene|hwa       LGYHTDHVEDHAMDLHVFIQSVTGTASDPAPLITAFESGYAETGIST---------VQSR
2045|gene|nrc1      LGYYTDAVEDYAMDCHVFEQSLVGTAADADALVAAFEDAYEEAAASGR--------VLDQ
5000|gene|hbo       LGYYTGHVEDHAMDLHVFGQSVEGTAAEPEPLLQAFEEGYAAVARDGEEGGGPDEDVLAR
1954|gene|hut       LGYYTGHAEDHAMDLHVFAQSLAGTADDPEALRSAAEDAYRETADEGGA-------VLDR
12490|gene|hma      LGYYTQEAEDHAMDLHVLAQSLAGTADDPETLLSAAEDAYRTESDHADA-------VFAS
2922|gene|hhi       LGYYTQEAEDHAMDLHVLAQSLAGTADDPETLLSAAEDAYRTESDHADT-------VFAS
                    *.*:*  .**:*** **:  :: .** :. .   * *..*   .            *   

2392|gene|hla       LRDVEGRGRYR------
5070|gene|nph       LREIETRGRYQ------
1341|gene|hwa       LRDIESRGRYH------
2045|gene|nrc1      LRAVEGRGRYQDDPETA
5000|gene|hbo       LRQVEGRGRYQ------
1954|gene|hut       LREIEGRGRYQ------
12490|gene|hma      LDDIEGRGRYQ------
2922|gene|hhi       LDDIEGRGRYQ------
                    *  :* ****.