HOG Organism Gene ID Name Annotation
aHOG2037 hla HLAC2037 Hlac_2037 Cupin 2 conserved barrel domain protein
aHOG2037 hmu HMUK1504 Hmuk_1504 Cupin 2 conserved barrel domain protein
aHOG2037 hma Hma_13415 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2037|chp|hla      MDVLPDADVEAVEAVDGVFLTQGAAGDETSIQRFVIDPGAEVPEHDHPHEQVGVITEGTI
13415|hp|hma      MEEVPQAACETVEAVDGVHLTQMAVGEEMSVQQFHIEPGAAVPEHSHRHEQVGYVVKGTF
                  *: :*:*  *:*******.*** *.*:* *:*.* *:*** ****.* ***** :.:**:

2037|chp|hla      TFVVDGEDRVVEAGDTYVIPGSEPHAARNDGDEEVVGYDIFSPPRANPDWQE
13415|hp|hma      TFHVNGEEYVIGPGDSYVVPSEEPHEARNDGEEPVRGIDVFSPPRPNPDWQD
                  ** *:**: *: .**:**:*..*** *****:* * * *:*****.*****: