HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0203COG0148KOG2670arCOG01169Enolasephosphopyruvate hydratase

HOG Organism Gene ID Name Annotation
cHOG0203 nrc1 VNG1142 eno phosphopyruvate hydratase
cHOG0203 hmu HMUK2598 Hmuk_2598 enolase( EC:4.2.1.11 )
cHOG0203 hma RRNAC0069 eno phosphopyruvate hydratase
cHOG0203 hwa HQ2935A eno phosphopyruvate hydratase
cHOG0203 hla HLAC1825 Hlac_1825 enolase
cHOG0203 hbo HBOR12470 Hbor_12470 enolase( EC:4.2.1.11 )
cHOG0203 hut HUTA2515 Huta_2515 enolase
cHOG0203 hvo HVO_2774 HVO_2774 eno phosphopyruvate hydratase
cHOG0203 nph NP2846A eno phosphopyruvate hydratase
cHOG0203 hhi 2387 HAH_2387 hypothetical protein
cHOG0203 hhi 828 eno phosphopyruvate hydratase
cHOG0203 hhi 4022 HAH_4022 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4022|hp|hhi         ------------------------------------------------------------
2387|hp|hhi         -----MCMERVEFTVRGE---------------------GAST-----------------
1142|gene|nrc1      MTRIEAVRYRPILDSRGNKTVEAEVTTDDGGFGRAAAPSGASTGEHEAVELPVGEAIAAG
2515|gene|hut       MTLITNVTLRRVLDSRGNPTVEADVTTESGGFGRAAAPSGASTGEHEAIELPPSEAIANA
2846|gene|nph       MTLITEVRLRKILDSRGNPTVEAEVRTENGGFGRGAAPSGASTGEYEAVERPAEEAIAQA
10069|gene|hma      MTLITDIRLRRVLDSRGNATVEADVLTESGGFGRGKAPSGASTGEYEAIELPANEAIAKA
828|gene|hhi        MTLITDIRLRRVLDSRGNATVEADVLTESGGFGRGKAPSGASTGEYEAIELPANEAIAKA
1825|gene|hla       MTRITGISLRRVLDSRGNPTVEADVLTESGGFGRGAAPSGASTGEYEAIELPANESIAKA
2935|gene|hwa       MTQITNVSLRRILDSRGNPTVEADVLTQSGGFGRAAAPSGASTGEYEAIELDPAEAIASA
12470|gene|hbo      MTLITDVRLRRVLDSRGNPTVEADVLTQSGGFGRAAAPSGASTGEYEAIELPPSEAIAAA
2774|gene|hvo       MTRITSVALRRVLDSRGNPTVEADVLTESGGFGRAAAPSGASTGEYEAIELPPTEAIAAA
                                                                                

4022|hp|hhi         ------------------------------------------------------------
2387|hp|hhi         ----LPR-----------------------------------------------------
1142|gene|nrc1      RERIAPRLEGREFAGDQRGVDAALHAADDTTDFSAVGANVAVATSMAAAKAAADVLGVHT
2515|gene|hut       RDLAVPRLEGEVYAGDQRSVDAALHAADGTDNFSEIGANSAVAISMAAAKAGADVLGAPL
2846|gene|nph       RELAVPRIEGQVYAGDQRGVDNALHGADGTDDFSEIGANSAVAISMAAAKAAADVLGAPL
10069|gene|hma      REEALPRLIGEVHAGNQRDVDAALHAADGTDDFSGIGANSAVAISMAAAKAGADVLGAPL
828|gene|hhi        REEALPRLIGEVHAGNQRDVDAALHAADGTDDFSGIGANSAVAISMAAAKAGADVLGAPL
1825|gene|hla       REHAVPRLEG-VYAGDQRAVDNALRAADGTDDFSAIGANSAVAISMAAAKAAADVLGAPL
2935|gene|hwa       RDHVAPRLIDTVHAGNQREVDAALHAADGTDNFSQIGANSAVAISMAAAKAGADVLGAPV
12470|gene|hbo      RRHAVPRLIEEVHAGNQREVDGALRAADGTDNFSEIGANSAVAISMAAAKAGADVLGAPL
2774|gene|hvo       RRHAVPRLVDEVHAGNQREVDATLRAADGSENFSEIGANSAVAISMAAAKAGADVLGAPL
                                                                                

4022|hp|hhi         ------------------------------------------------------------
2387|hp|hhi         ------------------------------------------------------------
1142|gene|nrc1      YQHLGGALRGRNFPVPLGNVLGGGAHAADATAIQEFLVAATGAPSVRQAVFANAAVHQRV
2515|gene|hut       YQHLGGTFRGDQFPTPLGNVVGGGEHAEEATNIQEFLSAPVGAPSVTEAIFANAEVHAEI
2846|gene|nph       YQHLGGAFRGRDFPVPLGNVIGGGEHAADATHIQEFLAAPVGAPSVADAVFANAKVHGEV
10069|gene|hma      YQHLGGTFRGNEYPTPLGNIIGGGEHAADATNIQEFLAAPVGAPSVEEAVFANAAVHQEV
828|gene|hhi        YQHLGGTFRGNEYPTPLGNIIGGGEHAADATNIQEFLAAPVGAPSVEEAVFANAAVHQEV
1825|gene|hla       YQHLGGAFRGENFPIPLGNVVGGGEHAKEATHIQEFLAAPVGAPSVSEAVFANAAVHAAV
2935|gene|hwa       YQHLGGTFRGESFPTPLGNVVGGGEHAKEATHIQEFLSAPIGAPNVSEAVFANAAVHARV
12470|gene|hbo      YQHLGGAFRGENFPVPLGNVVGGGEHAKEATHIQEFLAAPVGAPSVSEAVFANAAVHARV
2774|gene|hvo       YQHLGGAFRGDNFPTPLGNVIGGGEHAKEATNIQEFLAAPVGAPSVSEAVFANAKVHARA
                                                                                

4022|hp|hhi         --------------------------MALNTSKLHCNELASDFRYV--------------
2387|hp|hhi         ---------------------------AFHDIAEDSRELYDGNGFVVAVTENHYRMEL--
1142|gene|nrc1      KDRLDDDGVPAAKGDEGAWAPSIDDATAFDVVAGAAAEVADEFGFDVRLGLDLAAAERYD
2515|gene|hut       SEILEGRGVPVNKGDEGAWAPPIGDDEAFEVVAEATDRISDERGFEISFGLDMAAAEMYD
2846|gene|nph       QRQLDERGVPAAKGDEGAWAPSIDDSEAFEIMEEAIAAVEDEVGFEIRFGLDVAGAELYE
10069|gene|hma      HDILADRDLPAGKGDEGAWAPSVSDDEAFEIMDEAVETVADDFGFAISFGLDVAGAELYD
828|gene|hhi        HDILADRDLPAGKGDEGAWAPSVSDDEAFEIMDEAVETVADDFGFAISFGLDVAGAELYD
1825|gene|hla       ADVLDERGVPAAKGDEGAWAPPISDADAFEVVDEAVDRVEEDVGFEIRFGLDMAAAELYD
2935|gene|hwa       SEILDERGIPAAKGDEGAWAPPISDAEAFSLVNDAVADVEDDLGFEIRFGLDMAAAELYD
12470|gene|hbo      SEILDERDTPAAKGDEGAWAPPISDAEAFEVVDEAVSDVEDELGFEVRFGLDMAAAELYD
2774|gene|hvo       SEILDERGVPAAKGDEGAWAPPVSDAEAFEIMGEAVSDVEDELGFEIGFGLDIAASEMFE
                                               *:         : .   :               

4022|hp|hhi         ------------------------------------------------------------
2387|hp|hhi         ---------------TEVQATTVLELIDE-----------------------TTCEVTII
1142|gene|nrc1      GDE--YVF-GDDRRSTAAQIEYVAGLVSEYDLAYVEDPLDENDFEAFAELTDRVGDETLV
2515|gene|hut       AEEGVYEYEGEPDRTTQEQIDYVVEMVEEYDMAYVEDPLDENDFEAFAELTERVGDQTLI
2846|gene|nph       DGV--YHY-GDETRSPDEQVAYIADLVEEYNLVYVEDPLDEDDFSGFAELTERVGDRTLI
10069|gene|hma      DEADGYVY-DDGVKSTEEQIEYIAGKVEEYDLVYVEDPLDENDYEAFADLTAQVGDQTLV
828|gene|hhi        ADEDGYVY-DDGVKSTQEQIEYIAGKVEEYDLVYVEDPLDENDYEAFADLTAQVGDQTLV
1825|gene|hla       DDQEAYVY-GEETKSTDEQIDYVADLVDEYDLAYVEDPLDENDYEAFAELTDRVGDRTMI
2935|gene|hwa       DDVGGYVY-GDEVKSTTEQVEYVAEMIAEYNLVYVEDPLDENDYDGFATLTERVGDQTLI
12470|gene|hbo      DDEDGYVY-GDEVKSTDEQVDYVAEMVEEYDLVYVEDPLDEDDYEGFADLTERVGDQTLI
2774|gene|hvo       DGV--YHY-GDETKTTDEQIDYVAEMVDEYDLVYVEDPLDENDYEGFAELTERVGDRTLI
                                                                                

4022|hp|hhi         ----------------------------PTEIGTLSNGFSRVEASNLVVFELLQSRRPGN
2387|hp|hhi         AG------------------------------------------GGGSGLTANTSGRESE
1142|gene|nrc1      CGDDLFVTNTERLQRGIDAGAANSILVKPNQIGTLTDAVDAIELATRNGYDAVVSHRSGE
2515|gene|hut       CGDDLYVTNVERLQEGIDLGSSNSILIKPNQIGTLTDAVDAIELGSKNGIQSVVSHRSGE
2846|gene|nph       CGDDLFVTNTERLQRGIDDGAANSILIKPNQIGTLSDAFDAIELATRNGYDPVVSHRSGE
10069|gene|hma      CGDDLFVTNVERLQAGINADAGNSILIKPNQIGTLTDAVDAIELATASGYESVVSHRSGE
828|gene|hhi        CGDDLFVTNVERLQAGINADAGNSILIKPNQIGTLTDAVDAIELATASGYESVVSHRSGE
1825|gene|hla       CGDDLFVTNVERLQEGIDTGAANSILIKPNQIGTLSDTFDAIELAARNGYETIISHRSGE
2935|gene|hwa       CGDDLFVTSVERLQTGIDADAANSILIKPNQIGTLTDAFDAIELAREHGYETVVSHRSGE
12470|gene|hbo      CGDDLFVTNVERLQDGIDAGAGNSILIKPNQIGTLSDAFDAVELAVRNGYDAVISHRSGE
2774|gene|hvo       CGDDLFVTNVDRLQDGIDVGAANSILIKPNQIGTLTDAFDAVELASRNGMDAVISHRSGE
                                                                .         * * .:

4022|hp|hhi         RR---------------------------KLVANFRSMAQCH
2387|hp|hhi         EARKVRRRLET-----FCEDRDLTVERV--------------
1142|gene|nrc1      TEDTTIAHLAVATDAPFIKTGAVGGERTAKLNELIRIADEA-
2515|gene|hut       TEDTTIAHLAVGAAAPYIKTGTVAGERTAKLNELIRIEENA-
2846|gene|nph       TEDTTIAHLAVATDAPFIKTGAVGGERTAKLNELIRIEANA-
10069|gene|hma      TEDTTIAHLAVATDAPFIKTGAVGGERTAKLNELIRIEDNAV
828|gene|hhi        TEDTTIAHLAVATDAPFIKTGAVGGERTAKLNELIRIEDNAV
1825|gene|hla       TEDTTIAHLAVATDAGFIKTGTVGGERTAKLNELVRIADDAV
2935|gene|hwa       TEDVTIAHLAVATDAGFIKTGTVQGERTAKLNELIRIAEDAV
12470|gene|hbo      TEDTTIAHLAVATDAAFIKTGTVQGERTAKLNELIRIADDAV
2774|gene|hvo       TEDATIAHLAVATDAPFIKTGTVQGERTAKLNELIRIADDAV