HOG Organism Gene ID Name Annotation
aHOG2013 hbo HBOR23450 Hbor_23450 hypothetical protein
aHOG2013 hla HLAC0968 Hlac_968 hypothetical protein
aHOG2013 nrc1 VNG0399 vng399 no entry
MUSCLE (3.6) multiple sequence alignment


968|hp|hla        MTCRSRTGLVALTTLSVALLLVSATVVSGAFVG-GAAATPSGSSAAADGALGDGSDATDD
23450|hp|hbo      MRRFSRAVAVAVVAILI-------------VSGVGPVAAQSDAQSASNGD----------
399|hp|nrc1       ---------MAIVVLVA-------------FTG-GGAAQQAGSGPKVDGD----------
                           :*:..:               . * * .*  :.: .  :*           

968|hp|hla        RVDPPTRCFAGEGYPISIGDGGAAIEALVHLSVLTDPTAGNEFGLEAAGTLDGEPIVTLG
23450|hp|hbo      -----RRCFPPDGHELGIGTNGPGIAVTIHTSLFTNLGGAGALGIEARGSALNSTIIGLQ
399|hp|nrc1       -----------GGYRFDVGGDSPHITFWLHLDLLTNLGGAGDLGFSAVGTALDTRVIVID
                              *: :.:* ... *   :* .::*:  ... :*:.* *:  .  :: : 

968|hp|hla        AGVRLTAREAIANGV-DPFAAFDVLYAYELRLPMFD-GSIGDSEYRDEGSPI--------
23450|hp|hbo      TGVVFDGVGSADSFLSNPFSRFGILYDYSFQLPMFS-GMVDDPGYESDESPV--------
399|hp|nrc1       LQLQFDGIGPLEEFLSDPFSRFSVSAEWELNLPFLSAGPASDTEFSYEGNETIANNTSLE
                    : : .  .  . : :**: *.:   :.:.**::. *  .*. :  : .          

968|hp|hla        --DSGAGAVPC--------
23450|hp|hbo      ---KGVDSRSC--------
399|hp|nrc1       NATIGTDTLGNVTRNATQS
                      *..: