HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0020COG0365KOG1175arCOG04201Acyl-coenzyme A synthetases/AMP-(fatty) acid ligasesacetyl-CoA synthetase

HOG Organism Gene ID Name Annotation
cHOG0020 nrc1 VNG0997 acs2 acetyl-CoA synthetase
cHOG0020 hmu HMUK2167 Hmuk_2167 AMP-dependent synthetase and ligase( EC:6.2.1.1 )
cHOG0020 hma RRNAC3228 acs5 putative acetyl-coenzyme A synthetase
cHOG0020 hma RRNAC3230 acs3 acyl-coenzyme A synthetase
cHOG0020 hwa HQ1538A acs acyl-CoA synthetase I
cHOG0020 hla HLAC1306 Hlac_1306 acetate/CoA ligase
cHOG0020 hla HLAC1304 Hlac_1304 AMP-dependent synthetase and ligase
cHOG0020 hbo HBOR23260 Hbor_23260 acetyl-coenzyme A synthetase( EC:6.2.1.1 )
cHOG0020 hbo HBOR37600b Hbor_37600 hypothetical protein
cHOG0020 hbo HBOR37580b Hbor_37580 extracellular solute-binding protein, family 5
cHOG0020 hbo HBOR39570b Hbor_39570 acetyl-coenzyme A synthetase (EC 6.2.1.1)( EC:6.2.1.1 )
cHOG0020 hbo HBOR39550b Hbor_39550 extracellular solute-binding protein, family 5( EC:6.2.1.1 )
cHOG0020 hut HUTA2845 Huta_2845 acetate/CoA ligase
cHOG0020 hvo HVO_0894 HVO_0894 acsA acetate--CoA ligase
cHOG0020 nph NP5128A acs_3 acyl-CoA synthetase I 3
cHOG0020 nph NP5132A acs_4 acyl-CoA synthetase I 4
cHOG0020 hhi 483 acs2 acyl-coenzyme A synthetase
cHOG0020 hhi 481 acs1 acyl-coenzyme A synthetase
MUSCLE (3.6) multiple sequence alignment


37580|gene|hbo      -------------MANKQAD-YSSLVSRRRFIELTGVSGATALAGCSGGTDQEDGSTSDT
37600|hp|hbo        ----MSTTESITELD------VDDVSP-------GDVTIPTLRAAL-----TDD------
2845|gene|hut       -----MNENEDLELEARLPD-QDYYRPPAKFVGGANVTDPDVYDRF-----DE-FPDGFS
13230|gene|hma      MYCQLMTRGDEPDRGQSQTG-RETVEPPDWFVKQANVTDLAVYDRF-----EREWPDCWR
483|gene|hhi        -----MTRGDEPDRGQSQTG-RETVEPPDWFVEQANVTDPAVYNRF-----EREWPDCWR
1304|gene|hla       ----MDYAGVDGRRTNGLEDGDDAVEPPAGFSDRAVASDAGLYEAF-----AEEGPEAWR
39550|gene|hbo      -----MSNGRGPDSETGLGE-YEKIDPPTSFAEQATVTDESIYDEF-----NDTWPDCWE
5128|gene|nph       -----MDDGADVELAAWLEN-RTTFEPPASFVEQANVTDPDIYEAF-----EENWPDCWE
997|gene|nrc1       ----MSNDTDTPELEARLTD-QDEFTPPESFVEQANVSDPGIYDEF-----DATWPECWT
5132|gene|nph       -----MSDTDETQLEARLAD-QTEFEPPESFVEQANVTDPDIYEEF-----EENWPDCWE
1306|gene|hla       ------MTEGDGQLEARLAE-QEVFEPPESFVEQANVSDSGVYDEF-----EENWPECWE
13228|gene|hma      ------MSDEDVQLEARLEE-QEVFEPPESFVEQANVTDEGIYDEF-----EENWPECWE
481|gene|hhi        ------MSDEDVQLEARLEE-QEVFEPPESFVEQANVTDEGIYEEF-----TENWPECWE
1538|gene|hwa       ------MTDDDVELEARLAE-QESFDPPASFVDQANVTDEAIYDEF-----SENWPECWT
23260|gene|hbo      ------MSDGDGELEARLVE-QEEFEPSDEFVEQANVSDPAIYDEF-----EEDWPHSWE
39570|gene|hbo      -------------METRLED-EVAFEPPEDFVAQANVSDSSIYDEF-----AANWPECWE
                                              .         .:                      

37580|gene|hbo      NGETSSNTDPSSSDTVHDAELDGVNFLIPKNVQFNPYNPNNY------TQIGLDYVFDLF
37600|hp|hbo        ------------ENLVRD--------------RAAAVCV---------------------
2845|gene|hut       EYAELLTWEERWDETFDGSDPPFFEWFVGGSLNASVNCVDRHLAERK-NQAALIWEGE--
13230|gene|hma      EAAELLDWEKPFETVLRGTDGPPFEWFPDGRLNAAYNCLDRHLPERK-NQLALVWEGH--
483|gene|hhi        EAAALLDWEVPFETVLRGTDGPPFEWFPGGRLNAAYNCLDRHLPERK-NQLALVWEGH--
1304|gene|hla       RAADLLDWERPSETVLDDSDPPFYEWFPDGRLNAAANCVDRHLDERR-NQLAIRWFGK--
39550|gene|hbo      RAAATIDWSEPYECVLPNDEPPF-EWFAGGTLNASYNCLDRHIEAGAKNRVAIKWESH--
5128|gene|nph       RAADLLDWRRQWDTVLDDSDAPQYEWFADGQLNAAENCIDRHVEAGRKNQAAIRWVGK--
997|gene|nrc1       DAADLLDWETPYDQVLDDSNPPFYEWFPGGGLNASANCLDRHLDERG-DEAAIEWVGEP-
5132|gene|nph       RAADLLDWETDHDEVLVDDDEPFYEWFVGGELNASENCVDRHLEDRG-DELAIQWEGE--
1306|gene|hla       GAADLLDWESDYDQVLDDSNPPFYEWFTGGELNASANCLDRHLDDRG-DEVAIEWIGEP-
13228|gene|hma      GAADLLDWEEEYDQVLDDSNPPFYEWFTDGTLNASANCLDRHLDERG-DEAAIEWVGEP-
481|gene|hhi        GAADLLDWEEGYDQVLDDSNPPFYEWFTDGKLNASANCLDRHLEERG-DEAAIEWVGEP-
1538|gene|hwa       RAADLLSWDSEYSTVLDDSDEPFYEWFADGDLNAAYNCVDRHVEDGNKNRVAIKWEGE--
23260|gene|hbo      RAAEMLDWFEDYDEVLDDSEEPFYEWFVNGTLNASYNCVDRHVENGDKNRVAIKWEGE--
39570|gene|hbo      RAADLLDWDDEYEQVLDDSNPPFYKWFTEGKLNASYNCLDRHVENGDKNRAAIKWEGE--
                                .  . .              .                           

37580|gene|hbo      VQFNYAKGEFIHYAISDWTVEPEQATITIRDGLTWFNGDPVTSR-DIKTQFELQKYTGGE
37600|hp|hbo        -----------------------TFA-----------DEDVEVVLPLLP----AIVTAAR
2845|gene|hut       ------GGEQRTITYQDLHRQVNEMAAVLRE-VGVEEDDVVTLHLPMVPALPITMLACAR
13230|gene|hma      ------LGESRTYTYLELYREVNAFAAALRD-RGVGPDDVVTLYLPMVPELPVAMLACAR
483|gene|hhi        ------LGESSTYTYLELYREVNAFAAALRE-RGVGPDDVVTLYLPMVPELPIAMLACAR
1304|gene|hla       ------RGERRSYTYLDLHREVNALAAGLRD-LGVEEDDVVTLYLPMVPELPIAMLACAR
39550|gene|hbo      ------LGETRTYTYQDLYREVNEFAAALRA-QGVEEDDVVTLYMPMIPELPIAMLACAR
5128|gene|nph       ------RGETETYTYGDLKRETEAFAAALRD-LGVGEDDLVTLYLPMIPELPIAMLACAR
997|gene|nrc1       -----ADEANRTYTYAQLHREVNEFAAGLRE-MGVGEDDIVTLYMPMVPELPIAMLACAR
5132|gene|nph       ------LGETRSYTYEELHREVNECAAALRD-LGVGEDDIVTMYMPMVPELPIAMLACAR
1306|gene|hla       -----VDEDDRSYTYAELHREVNEFAAALRD-QGVEEDDVVTMYMPMIPELPIAMLACAR
13228|gene|hma      -----VEEDNITYTYEELHQKVNEFAAGLRE-MGVGEDDVVTMYMPMIPQLPIAMLACAR
481|gene|hhi        -----VEEDNITYTYEELHQKVNEFAAGLRE-MGVGEDDVVTMYMPMIPQLPIAMLACAR
1538|gene|hwa       ------HGNTRTYTYQDLYREVNEFAATLQE-LGVKENDVVTMYMPMIPELPIAMLACAR
23260|gene|hbo      ------HGETRTYTYQDLYREVNEFAAALLD-LGVEEDDVVTMYMPMVPELPIAMLACAR
39570|gene|hbo      ------LGETRTYTYQDLYREVNEFSAALRA-QGVEEDDVVTLYMPMIPELPIAMLACAR
                                             :           .: *     : .       : . 

37580|gene|hbo      LWQYAESVEMDGDTKLVINLAQETNPTIVKHTIAYNYTSVPHSVYGEYLKKIQEAESEEE
37600|hp|hbo        ---------------------------------------------------DENVNVALK
2845|gene|hut       IGAVHSVVFAGFSANALADRLVDADSDVVVSIDGYYRRGEWLDHKAKADEAVEAEETSVE
13230|gene|hma      LGVPHNVVFAGFSADALATRMERAESEYLITCDGYYRRGSAVAQKNKADNARITVDHDV-
483|gene|hhi        LGVAHNVVFAGFSADALATRMERADSEYLITCDGYYRRGSAVAQKNKADNARIAVDHDV-
1304|gene|hla       IGAPHNVVFAGLSAEALATRIDAADSEYLVTCDGYYRREDAFNQKSKADNARLRADVDLS
39550|gene|hbo      IGAPHNVVFAGLSADALATRLESADSEYLVTCDGYYRRGNAIFLKSKAEDARLKTPHDLS
5128|gene|nph       IGAPHSVVFAGFSANALETRMRNAEASYLVTCDGYYRRGDALNHKGKADRAVRNLDWDV-
997|gene|nrc1       LGAPHSVVFAGFSADALSTRMNAADSEYLVTCDGYYRRGDPLDHYAKTLDGLDGVSHAVS
5132|gene|nph       IGAPHSVVFAGFSADALATRMNAADSEYLVTCDGYYRRGDGLDHISKANEGLEGVDHET-
1306|gene|hla       IGAPHSVVFAGFSADALATRMNSAESEYLVTCDGYYRRGDPLDHLDKANQGLAGVEHDT-
13228|gene|hma      IGAPHSVVFAGFSADALATRMNSADSEYLVTCDGYYRRGDPLDHLDKANEGLSGVDHEVE
481|gene|hhi        IGAPHSVVFAGFSADALATRMDSADSEYLVTCDGYYRRGDPLDHLDKANEGLSGVDHEVE
1538|gene|hwa       IGAPHSVVFAGFSADALATRMNSADSEYLITADGYYRRGDALDHFQKAQEGLDNVEHDVA
23260|gene|hbo      IGAPHSVVFAGFSADALATRMNSAESRFLVTCDGYYRRGDALDHLEKANDGLGGVDHGVD
39570|gene|hbo      IGAPHSVVFAGFSAEALATRMNSADSEYLVTCDGYYRRGDSLDHLDKANEGLDGVDHDVE
                                                                                

37580|gene|hbo      ENKAIAEL----TEFAPTDPLGCGAFEKQSADKQQAIYTRNPDHPDAENINFERYRSNYT
37600|hp|hbo        AVTVLNVV---AQQQPTELNEATETLATLL-THDLPRVQ--LFAAKAVQTI---------
2845|gene|hut       TALLWSRHDELHEDVELTGEDPYVLVDDVLAGKQGAHVE--PVARDAEDPLFLMYTSGTT
13230|gene|hma      SVVVLDRL-----GRDVHLGDDYVDYHDLLAAHEGAEVE--PVSQAADDPLFRIYTSGTT
483|gene|hhi        SVVVLDRL-----GRDVHLGDDYDDYHDLLAAHEGEEVE--PVSRAADDPLFRIYTSGTT
1304|gene|hla       ETVVVDRL---GDALDVPLGDDEHEYEAIVDAHDGETVE--PVARDATDLLFVMYTSGTT
39550|gene|hbo      EMVLVEHL-----GEAEHLGETQHTYDELVSEHAGAEVA--PVDRSADDVLFLIHTSGTT
5128|gene|nph       ETVVVDRL---GGGLPHSLGDGQYDYGTLVDDYWGESVE--PVVRDAEDDLFVMYTSGTT
997|gene|nrc1       DVVVVDRLGANGDGFDHDRPAAHHDYDAVVAAHDGASVS--PVERDATDMLFLMYTSGTT
5132|gene|nph       TTVVVDRL---GDDLDHELGDDQLDYDDLVADYEGESVE--PVVRDAEDMLFLMYTSGTT
1306|gene|hla       TTVVVDRLGPNGDDFGHDLGDDQIDYGDLVADHEGAEVD--PVTRDAEDMLFLMYTSGTT
13228|gene|hma      RAIVAERL-MDGDGFDHDYADNQVAFEDVIDDNEGETVE--PVDRDAEDMLFLMYTSGTT
481|gene|hhi        RAIVAERL-MDGDGFDHDYAGNQVAFDDVIADNEGETVE--PVDRDAEDMLFLMYTSGTT
1538|gene|hwa       ASVVVDRLG--DDGFGHELSETQYDWDSLMDAHRGDRVA--PVERNAEDMLFLMYTSGTT
23260|gene|hbo      ATVVVDRLG--DDGFGHDLKGNQHDWDDLLDTHDGERVE--PVARDAEDMLFLMYTSGTT
39570|gene|hbo      SVVVVDRLG--GDGFDRDLRDNQHDWDDLLAEHDGHRVE--PVERDAEDMIFLMYTSGTT
                                                                  * :           

37580|gene|hbo      GGNQATWQALLSGKVDAAYTLFTPSRIVDQLPDHWRVGKPPSNWGYGLA-PNYNKSPLGK
37600|hp|hbo        ----GAE-HPE--------------------------------WFTSH------------
2845|gene|hut       GKPKGCQ-HRTGGYL--AYAAGTSKYVLDIKTTDTYWCAADIGWITGHSYIVYGPLALGT
13230|gene|hma      GQPKAVT-HTTGGYL--AHVAWTARSVLDIKPEDTYWCSADIGWITGHSYIVYGPLALGT
483|gene|hhi        GQPKAVT-HTTGGYL--AHVAWTARSVLDIKPEDTYWCSADIGWITGHSYIVYGPLALGT
1304|gene|hla       GRPKGVE-HATGGYL--SHVAWTTRNVLDVRPDDTYWCAADIGWITGHSYGVYGPLSVGT
39550|gene|hbo      GEPKRVE-HVTGGYL--AHVTWTSQAVLDLKPGDTYLCTANIGWISGHSYVVYGPLAVGA
5128|gene|nph       GEPKAVR-HTTGGYL--AQAAWTSHAVLDIKPDDTYWCSADIGWITGHSYIVYGPLALGS
997|gene|nrc1       GQPKGVT-HSTGGYL--SWAAWTSQAVLDIKPSDTYFCSADIGWITGHSYIVYGPLALGT
5132|gene|nph       GKPKGVK-HTTGGYL--SYAAWTSHSVLDVKPDDTYWCSADIGWITGHSYIVYGPLALGT
1306|gene|hla       GKPKGVK-HTTGGYL--SWVSWTSQSVLDIKPDDTYFCSADIGWITGHSYIVYGPLSLGT
13228|gene|hma      GKPKGVK-HSTGGYL--AWAAWTSQAVLDIKPEDTYFCSADIGWITGHSYIVYGPLALGT
481|gene|hhi        GKPKGVK-HSTGGYL--AWAAWTSQAVLDIKPEDTYFCSADIGWITGHSYIVYGPLALGT
1538|gene|hwa       GEPKGVK-HTTGGYL--AYTAWTAQSVLDLEPGDTYWCSADIGWITGHSYIVYGPLALGT
23260|gene|hbo      GEPKGVK-HTTGGYL--AYTSWTSHAVLDIKPEDTYWCSADIGWITGHSYIVYGPLSLGT
39570|gene|hbo      GQPKGVK-HTTGGYL--SYAAWTSHAVLDIEPEDTYWCSADIGWITGHSYIVYGPLALGT
                                                               *  .             

37580|gene|hbo      RE-MRQGIMYVLNRKQI--VNNAAPNSKIYPEIPTAIAASQQ--ERYL-GDEIDTFESYG
37600|hp|hbo        -----------PE-----PLLEALRADI--TD-PTS-----------------EATELTG
2845|gene|hut       TSVMYEGTPDYPDRSRLWEIAERYDVDIFHTS-PTAIRQFMKWGEEHLAGHDFD-FRHLT
13230|gene|hma      TTVLYNGTADHPEKDRLWELIEKYAVDVFYTA-PTAVRAFMKWGEQYPEQHDLSSLRLLG
483|gene|hhi        TTVLYNGTADHPKKDQLWELIEKYAVDVFYTA-PTAVRAFMKWGEEYPDRHDLSSLRLLG
1304|gene|hla       TTLLYEGSPDYPDRDRVWDLIERNAVSVFYTS-PTAIRSFMKWGAEYPEAHDLSSIRLLG
39550|gene|hbo      TTVMYEGTPNYPEKDRIWSLIEQNAVDVFYTA-PTAIRAFMKWGAEYPAQHDLSSLRLLG
5128|gene|nph       TTVIYEETPDYPEKSRIWELIERYEVSVFYTA-PTAIRAFMKWGKEHPDEHDLSSLRLLG
997|gene|nrc1       TTMLYEGAPDHPDKDRLWELVESYEATQLYTA-PTAIRSFMKWGVEYPDAHDLSSLRLLG
5132|gene|nph       TTVMYEGTPDYPDKDRMWEIVENYEVDQLYTA-PTAIRAFMKWGEEYPEQHDLSSLRLLG
1306|gene|hla       TTMMYEGTPDHPERDRLWEIVDEYDATQLYTA-PTAIRAFMKWGAKYPDAHDLSSLRLLG
13228|gene|hma      TTMMYEGTPDYPDKDRLWDIVEEYEADQLYTA-PTAIRAFMKWGKQYPEQHDLSSLRLLG
481|gene|hhi        TTMMYEGTPDYPDKDRLWDIVEEYEADQLYTA-PTAIRAFMKWGKQYPEQHDLSSLRLLG
1538|gene|hwa       TTVMYEGTPDYPERDRLWDIIEKYAVDVFYTA-PTAIRAFMKWGTEYPDSHDLSSLRLLG
23260|gene|hbo      TTVMYEGTPDFPERDRLWELVEKYAVDVFYTA-PTAIRAFMKWGTEFPERRDLSSLRLLG
39570|gene|hbo      TTVMYEGTPDYPECDRLWEIVEKYSVDIFYTA-PTAIRAFMKWGEKFPESRDLSSLRLLG
                                .      : :        .  **:                 .      

37580|gene|hbo      ADKTMTSKAEAKFEEAGLTKEGGQ-----WKDSSGS--VVELPILV---PSGWSDWVTAA
37600|hp|hbo        TMADPLQRQ-----FAAVSHGE-QFQQYSVQATAGNLLIE----IADRDPAAIAPYAPAI
2845|gene|hut       TVGEPIQPEAWQWYYDHVGDEDAVIVDTWWQTETGGHLITNLPALEDMKPGSAGRPCPGI
13230|gene|hma      TVGEPMDAHAWEWYREHIGGGECPVVDTWWQTETGAILVSTLPGVDEMKPGAAGTPLPGI
483|gene|hhi        TVGEPMDARAWEWYREHIGGGECPIVDTWWQTETGAVLVSTLPGVDEMKPGAAGTPLPGI
1304|gene|hla       TVGESITPKAWHWYRKHVGGGEAPIVDTWWQTETGAISLATLPGITPMKPGKVGPPLPGI
39550|gene|hbo      TVGEPINPRAWQWYYEHVGNEECPIVDTWWQTETGGMMIATLPGIDAMKPGVAGPPLPGT
5128|gene|nph       TVGESINPKAWKWYYEHIGNESCPIVDTWWQTETGGMMITTLPGVSTMKPGSAGQPLPGI
997|gene|nrc1       TVGEPINPRAWTWYYTHIGDESCPIVDTWWQTETGGMMVTGLPGVSTMKPGSAGRPLPGV
5132|gene|nph       TVGEPINPKAWKWYYKHIGNESCPIVDTWWQTETGGMMITTLPGIATMKPGSAGPPLPGI
1306|gene|hla       TVGEPINPRAWKWYYKHIGDEECPIVDTWWQTETGGMMITTLPGIKDMKPGAAGPPLPGL
13228|gene|hma      TVGEPINPRAWKWYYKHIGNEECPVVDTWWQTETGGMMITTLPGVKDMKPGSAGPPLPGN
481|gene|hhi        TVGEPINPRAWKWYYKHIGGEECPVVDTWWQTETGGMMITTLPGVKDMKPGSAGPPLPGN
1538|gene|hwa       TVGEPINPRAWKWYYTHIGHESCPIVDTWWQTETGGMMVTTLPGIGTMKPGSAGPPSPGI
23260|gene|hbo      TVGEPINPRAWKWYYKHIGNEECPVVDTWWQTETGGMMVTTLPGIGTMKPGSAGPPLPGI
39570|gene|hbo      TVGEPINPRAWKWYHEHIGNGECPIVDTWWQTETGGMMITTLPGISTMKPGAAGPPLPGI
                    :                :            :  :*   :     :    *.  .   .. 

37580|gene|hbo      QTAADQLSSFGFNS-------SLVSKDFGTVLKDWSNGNFTLASFYWLPGGAR-----SA
37600|hp|hbo        MDALTAEDLNVVAC----------------------------------------------
2845|gene|hut       EPALYEDDGTEIEAASGRAGNLVIERPWPGMLQTVYGDDDRFIDEYWRRFSDTDSDDWRD
13230|gene|hma      EASVVTRSGATAEP--NTAGELVVTRPWPGMPRALLDGTG------WGSAPDSA----EE
483|gene|hhi        EASVVDREGAAVES--DTAGELVVTRPWPGMPRALLDGTG------WGSAPDSA----GE
1304|gene|hla       DARVVDEDGDPVEP--GEPGYLTIAAPWPGMLRGLREGDERYRREYWLEGDD-------G
39550|gene|hbo      DAKIVDGSGEAVPP--NDAGYLVLTRPWPGMPLALRHGRR------WGREGTSEI-EVNG
5128|gene|nph       DAKVVGEDGEKVDP--GEAGYLVVDRPWPGMLRGLAGSDERFVDEYWQPFSDPDD---GE
997|gene|nrc1       DARVIDTDGDDVAG--GRAGHLTIQKPWPGMLQTLYENDERFIDEYWRVYSDTDSGDSAD
5132|gene|nph       DAQVVDESGEEVAP--GEAGYVTVNKPWPGMLRTLYRNDDRFINEYWEAYSDEEA---DE
1306|gene|hla       DVQILDTLGDEVEP--GKAGYLTVQKPWPGMLRTLYNNDERYIDEYWAEYSDTDSDDPDD
13228|gene|hma      DVRIVDTEGEEVEP--GRAGYLTVDKPWPGMLRTLYKNDERFIDEYWAEYSDTDSDDSDD
481|gene|hhi        DVRIVDTEGKEVEP--GRAGYLTVDKPWPGMLRTLYKNDERFIDEYWAEYSDTDSDDSDD
1538|gene|hwa       DATIVDTAGEDVDA--GRAGYLTVNKPWPGMLRTLYQNDERFIDEYWEEYSDPDT---DE
23260|gene|hbo      DARVVDPGGEEVEA--GRAGYLTVNKPWPGMLRTLYNNDERFISEYWEEYSDPDA---DE
39570|gene|hbo      DAQIVDTTGDEVEA--GRAGYLTVNKPWPGMLRTLYNNDERYISEYWEEYSDTDSDDPDD
                                                                                

37580|gene|hbo      FPYFP--------------------IAHQLTPEYSGSSGSSITWGFSGTEELTVPSR---
37600|hp|hbo        ---------------AAEILGRI-----------GQMEAVDTAALVPPLVECL-------
2845|gene|hut       WVYKTGDGAVHGQDGYYRVLGRLDDVMNVAGHRLGTMELESAVAEVEAIAEAAVVAREDR
13230|gene|hma      WRYYPEDSVSVDADGYITFLGRIDDAINVAGRRFSTKELESTVAGVTGVAEAAVVGADDE
483|gene|hhi        WRYYPEDSVSVDADGYITFLGRIDDAINVAGRRFSTKELESTVAGVTGVAEAAVVGADDE
1304|gene|hla       WRYRTGDGATVDEDGYVTILGRVDDVINVRTHRFNTAELESAIVGADGVTEAAVVGDDDG
39550|gene|hbo      WNYFTGDGARVDEDGYITVLGRIDDVINVSGYRLGTMEIESAIVDVEGVVEAAVVSVDNA
5128|gene|nph       WVYFSGDSAKVDEDGYITLLGRVDDVIPLGDFRIGAMEIESAIVGVKGIAEAAVV-----
997|gene|nrc1       WVYFPEDGAKVDDDGYITVLGRVDDVVNVSGHRLGTMEIESAIVDVPGVAEAAVVGGDHD
5132|gene|nph       WVYFPEDGAKIDDDGYITILGRVDDVINVSGHRLGTMEIESAVVDVEGVAEAAAVGGDHD
1306|gene|hla       WVYFPEDGAKIDEDGYITVLGRVDDVLNVSGHRLGTMEIESAIVGVEGVAEAAVVGGNHD
13228|gene|hma      WVYFPEDGAKIDDDGYITVLGRVDDVINVSGHRLGTMEIESAIVGVEGVAEAAVVGGDHD
481|gene|hhi        WVYFPEDGAKIDDDGYITVLGRVDDVINVSGHRLGTMEIESAIVGVEGVAEAAVVGGDHD
1538|gene|hwa       WVYFPEDGAKIDDDGYMTILGRVDDVLNVSGHRLGTMEIESAIVGVNGVAEAAVVGGDHD
23260|gene|hbo      WVYFPEDGAKIDEDGYITILGRVDDVLNVSGHRLGTMEIESAIVGVEGVAEAAVVGGDHE
39570|gene|hbo      WVYFPEDGAKIDADGYITILGRVDDVINVSGHRLGTMEIESAIVGVEGVAEAAVVGGTHD
                                                      .  .  .         *         

37580|gene|hbo      -TGSGTETVELKPAVKQLAQTIDEEKVRTQIRDLAWVANQELP-MLPIAEKQNQSWISSK
37600|hp|hbo        -------------------DSESEVVAARSITALGHIGSATAVEPLRSAAKRYDNGDLRE
2845|gene|hut       ERGHVPDVYVVLRDGVEASDDVRKQVIASVEDEIGAFARPDRVLFVSDLPKTRSGKIMRR
13230|gene|hma      TTGTAVYVFASPEDGYAESE-LQTAIEDAIVNAIGGIARPKEVVFTPDLPKTRSGKVMRR
483|gene|hhi        TTGTAVYAFASPEDGYAESE-LRAAIEEGVVNAIGGIARPKEIVFTPDLPKTRSGKVMRR
1304|gene|hla       ----KIVAYVTTRGDIDPDESLRETIGERLAQAVGDVARPDRIVFTPDLPKTRSGKIMRR
39550|gene|hbo      ETG-GVHAYVTLEAALSGDEQMRERIASHVRERIGPIATLDAVVFTPDLPKTRSGKIMRR
5128|gene|nph       TTGSELLAYVSTERGYTGDAVLRRRVVDAVEDDIGEVAVPDHVVFAPELPKTRSGKIMRR
997|gene|nrc1       LKGEAVYAYVLTTDDHDASDALRERIVASVEDAIGPIARPEAVVFAPELPKTRSGKIMRR
5132|gene|nph       MKGEAVYTYVILEDGYEESEEMRQSIVEGVEDGIGPIARPEQVIFTPELPKTRSGKIMRR
1306|gene|hla       IKGEAVYAYVTTEDGYEGNDELRDAIITGVEDAIGPIARPEQVVFTPDLPKTRSGKIMRR
13228|gene|hma      IKGEAVYAYVITEDGYDEDEELRSAIIDGVEDAIGPIARPEAVIFTPELPKTRSGKIMRR
481|gene|hhi        IKGEAVYAYVITEDGYEEDEDLRSAIIDGVEDAIGPIARPEAVIFTPELPKTRSGKIMRR
1538|gene|hwa       LKGEAVYAYVITEDGYAEDEDLRESIIKGVEDGIGPIARPEQVIFTEELPKTRSGKIMRR
23260|gene|hbo      VKGEAVYAYVILEDGYEGTDEMRDKIVAGVEDAIGPIARPEQVVFTPELPKTRSGKIMRR
39570|gene|hbo      IKGEAVYAYVITEDGYEGDSDFHERIIEGVNDAIGPIARPEEVVFTPELPKTRSGKIMRR
                                                     :. ..            *  ..     

37580|gene|hbo      GWNLPPEGS---DKYSAKWPCSWLPRQGDMTYAGE---------
37600|hp|hbo        L--------------AVRTADWLDRERA----------------
2845|gene|hut       VLENISNKEDLGDTTTLRDPSVPDQIREQIQTNGGESPRS----
13230|gene|hma      LLTSVANDEDLGDTSALRNPEILGEIQSTT--RRK---------
483|gene|hhi        LLTAVANDEDLGDTSALRNPEILGEIQSTT--RKE---------
1304|gene|hla       LLEDIARGDEFGDVSALRNPEVVGEIESAV--REE---------
39550|gene|hbo      FLENIANGEEFGDTSTLRNPEIVGELKSIV--RDD---------
5128|gene|nph       LLEDIATGEELGDISALRNPETVGELRARL--AGETRSYLESEN
997|gene|nrc1       LLEDIANDADLGDTSTLRNPDVVETIQDQL--AGD---------
5132|gene|nph       LLEDIANDDDLGNTSTLRNPDIVDDIQEKV--RSD---------
1306|gene|hla       LLENIADGEELGNTSTLRNPEIVEEIQQKA--KGE---------
13228|gene|hma      LLEDIANGEELGDTSTLRNPDVVSDIETKV--QGD---------
481|gene|hhi        LLEDIANGEELGDTSTLRNPDVVSDIETKV--QGD---------
1538|gene|hwa       LLEEIANGEELGDTTTLRNPEIVDEIEAKV--SGD---------
23260|gene|hbo      LLEEIANDEELGDTTTLRNPEIVTEIQSKV--QND---------
39570|gene|hbo      LLEDVANGDELGNTSTLRNPEIVEEIESKVNAQSD---------
                                   : . .