HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0196arCOG04580hypothetical protein

HOG Organism Gene ID Name Annotation
nucHOG0196 nrc1 VNG1236 vng1236 no entry
nucHOG0196 hmu HMUK2356 Hmuk_2356 Methyltransferase type 12
nucHOG0196 hma RRNAC0513 hypothetical protein
nucHOG0196 hwa HQ3351A tyrA operon protein
nucHOG0196 hla HLAC1780 Hlac_1780 Methyltransferase type 12
nucHOG0196 hbo HBOR19120 Hbor_19120 methyltransferase family protein
nucHOG0196 hut HUTA0272 Huta_0272 Methyltransferase type 12
nucHOG0196 hvo HVO_1313 HVO_1313 conserved hypothetical protein
nucHOG0196 nph NP3360A tyrA operon protein
nucHOG0196 hhi 1128 HAH_1128 type 12 methyltransferase
MUSCLE (3.6) multiple sequence alignment


3360|gene|nph       --MTDTEAVLDTARYLREVRPIDPEEIYEYVDGQPHPAVVRQTLREHAFELGLKEREDGA
3351|gene|hwa       --MIDREAVRTNAKYLRNVRPIDPNEIYEYIEDQPHPAVVRETLRQEAFELGLRERADGT
1780|gene|hla       --MIDREAVRNNANYLRNVRPIDPEEIAEYIEGSPHPAVVRETLREEAFDLRLREREDGA
19120|gene|hbo      --MIDRDAVRSNAKYLRNVRPIDPEEICEYIEGTPHPAVVRETLREEAFDLGLVERDDGT
1236|chp|nrc1       -MPVDRGAVRDAAKYLRGVRPLDPAALREYVPGQPHEAVVRQVLREQAADLGIIERADGT
272|gene|hut        MNPDQRDAILDSVRYLRNVRPIDPDEIREYVPDQPHPGVVTQTIRESAVELGLSERADGT
10513|hp|hma        MNQDTRQQIRDNAQYLRNVRPLDPEELHEYVEGQPHPAVVKQVLREEAFDLGIVEQDDGT
1128|gene|hhi       MNQETRQQIRENAQYLRNVRPLDPEELHEYVEGQPHPAVVKQVLREEAFDLGIVEQDDGT
                            :   ..*** ***:**  : **: . ** .** :.:*: * :* : *. **:

3360|gene|nph       FVPVEDGTVHPDFTGVERFPEQYARQLESLLVDRYGAGWPDSDAGDRLREHIDQLKVDYF
3351|gene|hwa       FVPASTDPIPDPMWQPDMLPRRYNEVIADHLVERFGPEWYRGDSGAMLRSTIRRLKRDYY
1780|gene|hla       FEPVSEEPVPAPGWAPTALPENYSFALEDLLVREFGANWHREESGDKLREAVRRLKDDYL
19120|gene|hbo      FVPVEDEPVPYRDWSPTEFPEAYAFAFEDLLIERYGVNWHRDESGDRLREVIRRLKEDYY
1236|chp|nrc1       FVVPPEEPVGPPFNGVSALPERYERVVEAELTAAYGPDWHRGDTGDSLRETIRRFKDDYY
272|gene|hut        FVPAPEGPLDASVDRVETFPDGYTRIVEDQLVGEFGAGWPTGESGATLRSRIRAVKESYL
10513|hp|hma        FVPAPEGRLSVDFDGVERFPDSYEQQVIDLLTEWGGLEWHSGDSGDELRERIRDIKERYL
1128|gene|hhi       FAPAPEGRLSVDFDGVERFPDRYEQQVIDLLTEWGGLEWHSGDSGDELRERIRDIKERYL
                    *       :         :*  *   .   *    *  *   ::*  **. :  .*  * 

3360|gene|nph       ADADVTYDEETALAYALYHLPDYYAAIQYVLDDLGSAGLLGRRLRVLDVGAGTGGPMLGI
3351|gene|hwa       QQNPVEYDQTVALGYAIYHFSDYYAAIGYVLDDLLEQGCLSQTLRILDVGAGVGGPAAGI
1780|gene|hla       YGNDVAYDRVAALGYAIYHLPAYYATIGYVLDDLTENGLLDRTLRVLDVGAGVGGPALGL
19120|gene|hbo      YQNEVAYDEEAALGYGIYHLPDYYAAVGYVLDGLAERGLLPRVLRVLDVGAGTGGPALGL
1236|chp|nrc1       RRNPVEYDREVALGYAVYHLAGYYAAVQYVLAGLARDGLLGHDLRVLDLGAGVGGPAVGL
272|gene|hut        QGEDVAYDRLTALAYAIYHLPDYYAVGQYALGPLLADDRLPAQLRVLDIGAGVGGPALGL
10513|hp|hma        QGQAVEYDELTALGYAVYHLPDYYAVAKYVLADLAADGLLPSQLRVLDVGAGVGGPAVAL
1128|gene|hhi       QGQAVEYDELTALGYAVYHLPDYYAVAKYVLADLAADGLLPSQLRVLDVGAGVGGPALAL
                        * **  .**.*.:**:. ***.  *.*  *   . *   **:**:***.***  .:

3360|gene|nph       HEYLPEE-TLVDYDAVEPSAAADVFEQMASETRRGFEPTLYRETAESFSP----------
3351|gene|hwa       HDYLPES-SLVEYHGVEPSAGVDLLTDILAETRRNFRTTIHHESAESFDPTC--------
1780|gene|hla       HDYLPDD-AVVDYHAVEPSAAADVLDRMLDETGRNFRPTIHEETAESFFGI---------
19120|gene|hbo      HDYLPEN-SLVEYHAVEPSASADVLEAMLSETRSNFKTTVHRETAEAFDPASVLP-----
1236|chp|nrc1       FDFLPDE-ALVEYHAVEPSAAADVLDALLAETPRNVHTTIHRETAESFQP----------
272|gene|hut        LDLVCDAGGIVDYHAVEPSAAADVLSELLDETARNAHTTVHRERAEDFEP----------
10513|hp|hma        RDLLPDD-ALLDYHAVEPSAAADVLEHLLEDSGQNVRWEIHRALAEEFDPSSPLVGDDSG
1128|gene|hhi       RDLLPDD-ALLDYHAVEPSAAADVLESLLEDSGQNVRWEIHRAVAEEFDPSSPVPGDDSG
                     : : :   :::* .*****..*::  :  ::  .    ::   ** *            

3360|gene|nph       -------DGD----------YDLIVFANVLSELSQPAAVFERYLDHLADDGTVVAVSPAE
3351|gene|hwa       -------IGSADNERP----FDVILFGNVLSELDEPYIVARRYLSAVATDGSFIGLAPAD
1780|gene|hla       -------DGGAKSGDNDPDEFDLVVFGNVLSELDDPVAVVEAALGRLADDGSVVAFAPAD
19120|gene|hbo      -------DGE---------GFDLVCFANVLSELDDPTSVAERYLDYVADDGSFVGIAPAD
1236|chp|nrc1       -------AGE----------YDLVLACSVLSELDDAASVLRKYADAMAADGTALALAPAD
272|gene|hut        -------DGT----------FDLIVFSNVLDELESPATVLEHYGDALEPDGSILALSPAD
10513|hp|hma        SGAG---DGDSGSDDSTDEGYDLIIFGNVLSELDDAAATLYRYVEALADDGTLLALAPAD
1128|gene|hhi       GAGGDDSGGDSDGGDNNAEGYDLIIFGNVLSELDDAAATLYRYVEALADDGTLLALAPAD
                            *           :*::   .**.**...  .       :  **: :..:**:

3360|gene|nph       ERTATRLRDIEREV-----------------------------LDRRPDATVYAPTIRLW
3351|gene|hwa       KHTSIHLRAIERMLTGDPLTEPILEDEGQILSERAGDLTPAATPDDEIDATIYAPTLRLW
1780|gene|hla       RNTAMGLREVERAV-----------------------------ATPETGVETYSPTLRLW
19120|gene|hbo      LNTSMGLREVERAL-----------------------------APADGDVTVYAPTLRLW
1236|chp|nrc1       KHTSTHLRAVERAV------------------------------ED-DPFTVYGPTPRLW
272|gene|hut        KRTATGLRTIERAV------------------------------ED--TYTIYAPTVRLW
10513|hp|hma        RNTAIQLRTVEREV------------------------------ADGGPATVYGPTVRLW
1128|gene|hhi       RNTAIQLRQVEREV------------------------------ADGGPATVYGPTVRLW
                     .*:  ** :** :                                      *.** ***

3360|gene|nph       PDESPSDRGWTFTRQADIEPPAFQTRLDAAAADDAAADGIAAG---------GDGTYTKT
3351|gene|hwa       SGKTPSDRGWSFDRRSRVTAPPTQQQLDDAPRVVNKSETTAAGQMDRDSETAGDGRFRNE
1780|gene|hla       PDATPSDGGWSFDVADDLDIPPFQRRLDETAERGSTD---------------EPGEFVNV
19120|gene|hbo      PGHAPSDHGWSFDRGEDIVAPSFQRRLDEAGEATEDRD----P---------GDGTFTNE
1236|chp|nrc1       PDRRPTDSGWSFDERPAVEVPAVQSRLADASQ--------------------DPGEFRHT
272|gene|hut        PGETPAGECWSFDRKPDLAAPPFQQRLDDACDDTDH----------------DDGEFRNT
10513|hp|hma        PHQSPNSESWSFDRKPDIEVPTMQQRLDDPAG--------------------GTGEFVNT
1128|gene|hhi       PHQSPDSESWSFDRKPDIEVPTMQQRLDDPAG--------------------GTGEFVNT
                    .   * .  *:*     :  *. * .*  .                        * : : 

3360|gene|nph       TVQYAYLLLRTDGRRAIEYTPDPDTVAKMADMDAHVTDRIDLAALKLSPDLSS-------
3351|gene|hwa       TVQFSYTIIRRDGTARAPVSANPRRHAAMETMETHVTNRIDLIAVKLSHDLTTSPTENSN
1780|gene|hla       DVQFAYAILRPDGKRRVDVQANDGRCARMADSEEHVTDRVNYLAVKLSHDLSD-------
19120|gene|hbo      TVQFSSVVLRHDGERRVDVTASGERYAKMAEMERHVTNRIDLLAVKLSHDLTEHD-----
1236|chp|nrc1       DVRFSYSLLRRDDRRRHAVELSGDRLLALGDADDRVTDRADLLVAKLSRNLAGA------
272|gene|hut        DVQYAYSILRRDDATAIEYRPDESRVTTMADADSYVTDRVDVVGIKLSPDLSSGP-----
10513|hp|hma        DVQFAYSVLRTDGKRVHDVTPDRGIHAPMADAENYVTDRVNFLGVKLSHDLAERE-----
1128|gene|hhi       DVQFAYSVLRTDGKRKHDVTPDRGIHAPMADAENYVTDRVNFLGVKLSHDLAERE-----
                     *.::  ::* *.        .      :   :  **:* :    *** :*:        

3360|gene|nph       ---------------DGNPLYKISDGSEAVDHYAVLTRESSLNRELPAAPYGSLLRFENV
3351|gene|hwa       QYRRGHGSSNLQTSYDTNPVFKIGDGSQTTDHYAVVTVKDTLTEPLLTAEYGAILAFENV
1780|gene|hla       ---------------GDNALYRVGDGSQTVDHYLVCTRETVLNDDLRTADYGSVVFVENG
19120|gene|hbo      ---------------GANPLFKVSDGSESVEHYAVLTKRDSLNEWLARADYGDVLVFENV
1236|chp|nrc1       ---------------DANPVFRVSDGSQTTDCYAVLVRPTSLNGGIEAADYGDLVSIEDA
272|gene|hut        ---------------DANPLFLVGDGSEAIDHFAVLTRESTLNRGLVESQYGDLLSFENA
10513|hp|hma        ---------------GANPLYLLGDGSQQVDHFAVLTEASILNEDLRKADYGDLLSFENA
1128|gene|hhi       ---------------GANPLYLLGDGSQQVDHFAVLTEASILNEVLRKADYGDLLSFENA
                                   . *.:: :.***:  : : * .    *.  :  : ** :: .*: 

3360|gene|nph       LVLWNDDEDAYNLVVDDETVVDRLA--
3351|gene|hwa       LCLWNDDEDAYNLVVDDESVIDIIA--
1780|gene|hla       LVLWNDDEGAYNVVVDDETVVDLVAP-
19120|gene|hbo      LALWNDDEGAYNLVVDGETVVDRVA--
1236|chp|nrc1       LVLWNDDEDAYNLVVDEETVVDAV---
272|gene|hut        LALWNDDEGAYNLVVDAETVVDSVPVP
10513|hp|hma        LVLWNDDEEAYNVVVDGETVIDRAR--
1128|gene|hhi       LVLWNDDEEAYNVVVDGETVVDRAR--
                    * ****** ***:*** *:*:*