HOG Organism Gene ID Name Annotation
aHOG1946 hbo HBOR16120 Hbor_16120 hypothetical protein
aHOG1946 hmu HMUK0913 Hmuk_0913 conserved hypothetical protein
aHOG1946 hma Hma_10808 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


16120|hp|hbo      MKHRRTLLLVVVVALAALAGCSG-GADDDSGR-------AELHRSDDGAATAAPTVETTS
10808|hp|hma      --MASRIRVLAVVGLLLLAGCTGMGGSGDAGEAQGGGDGAQMSSGGDGSSQPVEADSKAS
                        : ::.**.*  ****:* *...*:*        *::  ..**:: .. : ..:*

16120|hp|hbo      SGASGGANSDSAASSKTANVQNRALIKTGTVRVEVDDFQASKSNLTAAVQGYGGFVSDTS
10808|hp|hma      AGDSENIQAGDAAA-------DRAIIRNGRMVVEVENYSATANAIAARARTSGGYVSDSN
                  :* * . ::..**:       :**:*..* : ***:::.*: . ::* ..  **:***:.

16120|hp|hbo      QERHSVDNETYLTGQVVLRVPAADFDALVEDAKAEGEVEVVKTNTEDVTDRLVDLEARLE
10808|hp|hma      RELHRDDGETWYTGYIVVRVPSEEYEPTQSMVSKQGTVRSEETTTKDVTDKLVDLEARLT
                  .* *  *.**: ** :*:***: :::.  . .. :* *   :*.*:****.******** 

16120|hp|hbo      NLRAQRDQLRKLYDEANTTEDVLAVQRELSDVQGEIERLEAQKQSLQDRVAFSTLTVRLE
10808|hp|hma      NLRERRDRLRTFYERANSTEELLRIEEELSSVQSDIERLEAQKRSLEQRVAYSTLRVEIH
                  *** .**.**.:*: **:**::* :: ***.**.:********.**::***:*** * : 

16120|hp|hbo      EPRPTPDRVAPDRWYDTPVLSAFFQSVDGVATVARALVVGLAYALPYFLVFVFPFV----
10808|hp|hma      EPAPEPS-AQQVPYHEQSLVAAFLSSVTDVYVFTRGLLVTAASLAPWLVVLAVPVVGGRR
                  ** * *. .    ::: .:::**:.** .* ..:*.*:*  *   *:::*:..*.*    

16120|hp|hbo      LLGGLAWRF---------------------RHRLLPHS---------
10808|hp|hma      LLRGRSLSVLGRRGTSESAIEDGDDGSSDPQQEPTPEPTDESPDDDA
                  ** * :  .                     .:   * .