HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0194COG0500KOG4300 KOG1269 KOG1331 KOG1499 KOG1541 KOG1975 KOG2793 KOG3010 KOG3045arCOG04583SAM-dependent methyltransferaseshypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0194 nrc1 VNG0821 vng821 no entry
cHOG0194 hmu HMUK2566 Hmuk_2566 Methyltransferase type 11
cHOG0194 hma RRNAC0542 methyltransferase
cHOG0194 hwa HQ1601A S-adenosylmethionine-dependent methyltransferase
cHOG0194 hla HLAC1030 Hlac_1030 Methyltransferase type 11
cHOG0194 hbo HBOR22130 Hbor_22130 methylase involved in ubiquinone/menaquinone biosynthesis
cHOG0194 hut HUTA2530 Huta_2530 Methyltransferase type 11
cHOG0194 hvo HVO_1032 HVO_1032 methyltransferase
cHOG0194 nph NP3110A S-adenosylmethionine-dependent methyltransferase 2
cHOG0194 hhi 1099 HAH_1099 methyltransferase
MUSCLE (3.6) multiple sequence alignment


1601|gene|hwa       --MTDTPQDS---------VKATYDTIAEHFAATREYAWPEVESFCASQQIQSPPD----
2530|gene|hut       ---MDRSRAD---------VRETYDRIGTHFSKTRVNPWPEVEAFVADAAD---------
1030|gene|hla       ---MDPQSAGD--------PQSTYDRIAAHFSKTREYAWPEVESFLDGRTA---------
22130|gene|hbo      MVRDDRSLPDDA-----ETPHETYDRIAEHFSSTREYPWPEVESFLDDYAADATDAASVT
821|chp|nrc1        --MTDTPHAAD------RDVQRTYNRIASHFAKTREYPWPEVESFLDEECA---------
3110|gene|nph       --MDDRPG-----------VRATYERIADHFAETREYPWPEVESFCADRHV---------
10542|gene|hma      MSPSDSSGDSDDPARSRAAVRRTYEDIGDHFSKTREYAWPEVESFVDESGS---------
1099|gene|hhi       MPPADPSADSDEPARSRAAVRRTYEDIGDHFSKTREYAWPEVESFVDECGS---------
                        *               . **: *. **: **  .*****:*               

1601|gene|hwa       ------------TESIGVDIGCGNGRHAETLFEQTSLDKIIGVDVSRELLHTAQTRATNR
2530|gene|hut       -------------ADLGLDVGCGNGRHVEILKQRA--GRVVGVDASRSLLDAATERVPD-
1030|gene|hla       --------------TRGLDIGCGNGRHTELLAERA--DAVVGVDLSRELLREAVARARER
22130|gene|hbo      MGSAEADSEVETPPARGLDLGCGNGRHAEVMAEHV--ESVVALDASRGLLDQARERSAER
821|chp|nrc1        ------------APAVALDLGCGNGRHAELLAAQA--ADVVCVDASTGLLSEARDRAAAN
3110|gene|nph       --------------VTALDVGCGNGRHTELLGAHA--DHVIGIDASGRLLALARERAPN-
10542|gene|hma      -------------VGTALDAGCGNGRHAELLAGVA--DRVVGLDASRALLRAATDRVGDS
1099|gene|hhi       -------------VGTALDVGCGNGRHAELLAGVA--DRVVGLDASRALLRAATDRVGDS
                                    .:* *******.* :   .    :: :* *  **  *  *    

1601|gene|hwa       GFIDDLALIQADAGSLPLESQSVSIVVYVATLHHLRSRRRRVASLSAVARVLESDGRALI
2530|gene|hut       -----GRFLLGDASNLPIATDRVDLALYIATLHHLPSREARIESLDELARVLDPDGEAFV
1030|gene|hla       GYDGTASFVHGDAATLPIATDAVGVAVYVATLHHLPSREARVRSLDELARVLAPGGTALV
22130|gene|hbo      GFS--ANLVQGDAASLPLRDDSVSLAVYVATLHHLRPRSARVASLSELARVLAPGGRALV
821|chp|nrc1        DFD--ATLVAGDAACVPVASGTVDIAVYVATLHHLRDRDARVASLTELARVLAPEGTALV
3110|gene|nph       -----AAFLEADAAALPLADGVVDLAVYVATLHHLPSRELRRQSLDELARVLDESGTALV
10542|gene|hma      -----VALLQGDATRLPLAAGAVDLAVYVATLHHLPSQTARRASLDELARVLAPGARALV
1099|gene|hhi       -----VALLQGDATRLPLTAGSVDLAVYVATLHHLPSQAARRASLDELARVLAPGARALV
                           :: .**  :*:    *.:.:*:******  .  *  **  :****   . *::

1601|gene|hwa       SVWSTEHDQFERS----NGFDTTIEWTLPDGTSIPRYYHIYDPVEFRSDLESSALSIVET
2530|gene|hut       SAWSTTHDNFDAPPDAEMGFDTTVEWTLPGGETVPRFYHIYAPAEFQADVEASQLSLDAF
1030|gene|hla       SAWSTAHDRFDRE----EGFDTTVDWTLPGGETVPRYYHIYSPAEFEIDLGESALSVVDV
22130|gene|hbo      SAWSVEHDRFDAT----DGFDTTVDWTLPGGEPVPRYYHIYDTDEFAADLEDSTLSVVES
821|chp|nrc1        SAWSTAHDRFDAT----TGFDTTVDWTLPGGETVPRFYHVYDPDEFDADLAASDLRVVSS
3110|gene|nph       SAWSTAHDRFDADEDAEDGFDTDVEWTLPGGETVPRFYHIYAPAEFDTDIAESDLTAVDS
10542|gene|hma      SAWSTAHDHFDADPDADEGFDTTVDWTLPGGETVPRFYHIYAPAEFERDVADSDLRLVSM
1099|gene|hhi       SAWSTAHDRFDADPDADEGFDTTVDWTLPGGETVPRFYHIYAPAEFERDVADSDLRLVSM
                    *.**. **.*:       **** ::****.* .:**:**:* . **  *:  * *     

1601|gene|hwa       EISSGNCYAVVEDN---------
2530|gene|hut       ELSNGNCYGTVSPASH-------
1030|gene|hla       DISSGNCYATVTASDA-------
22130|gene|hbo      FVSSGNCYAVVAPADDPAITDSC
821|chp|nrc1        TVSSGNCYAVVAPA---------
3110|gene|nph       FVSSGNCYAVVEAA---------
10542|gene|hma      ELSSGNCYGVVEPEGKRT-----
1099|gene|hhi       ELSSGNCYGVVEPEGKRT-----
                     :*.****..*