HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0193COG0436KOG0258 KOG0257arCOG01130Aspartate/tyrosine/aromatic aminotransferaseaspartate aminotransferase

HOG Organism Gene ID Name Annotation
cHOG0193 nrc1 VNG0629 aspB2 aspartate aminotransferase
cHOG0193 hmu HMUK1911 Hmuk_1911 aminotransferase class I and II
cHOG0193 hma RRNAC1434 aspC3 aspartate aminotransferase
cHOG0193 hwa HQ1632A aspC aspartate aminotransferase
cHOG0193 hla HLAC0832 Hlac_832 aminotransferase class I and II
cHOG0193 hbo HBOR21520 Hbor_21520 aspartate/tyrosine/aromatic aminotransferase
cHOG0193 hut HUTA0710 Huta_0710 aminotransferase class I and II
cHOG0193 hut HUTA0713 Huta_0713 None
cHOG0193 hvo HVO_0973 HVO_0973 aspB aspartate aminotransferase
cHOG0193 nph NP4410A aspC_3 aspartate aminotransferase
cHOG0193 hhi 2018 aspB5 aspartate aminotransferase
cHOG0193 hhi 1697 HAH_1697 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1697|hp|hhi         ----MGTAVLIFTFKPLTS-----------------------------------------
629|gene|nrc1       ----MNFSTRVTSVEPSATLAVSTLASELEADGVDVVDLSVGEPDFDTPESIVDAGKAAM
11434|gene|hma      --MTMDFASRVERVEPSATLAISNKAAELEAEGKDVVDLSVGEPDFDTPENIKDAAKDAL
2018|gene|hhi       ----MDFASRVERVEPSATLAISNKAAELEAEGKDVVDLSVGEPDFDTPENIKDAAKDAL
710|gene|hut        ----MDFAERVTRVEPSATIAISNLAAELEADGVDVVDLSVGEPDFDTPENVKNAAKEAM
713|hp|hut          ------------------------------------------------------------
4410|gene|nph       --MTMDFTARLERVEPSATLAISNLASELEADGVDVVDLSVGEPDFPTPENIVEAGKDAL
832|gene|hla        MSDAYDFSERIGRVEPSATLAISNLAAEKEAEGADIVDLSVGEPDFDTPANVVEAGKDAL
1632|gene|hwa       --MNFEFASRIERVEPSATLAISNKASELEANGVDVVDLSVGEPDFPTPQNVVEAGKDAM
21520|gene|hbo      --MSFDFAARVERVEPSATLAISNKASELEAQGVDVVDLSVGEPDFPTPQNIIDAGQDAM
                                                                                

1697|hp|hhi         ---------------------------GL---------------FVLFDRFLTV------
629|gene|nrc1       DAGHTGYAPSNGVPELRDAIAEKLQGDGL-DYEAGNVIVTPGAKQALYETFQAVVDEGDE
11434|gene|hma      DAGHTGYTSSNGIPELKEAIANSLHDDGLTQYGPDNLIVTPGGKQALYEIFQTIIDDGDE
2018|gene|hhi       DAGHTGYTSSNGIPELKEAIADKLHDDGLTQYGPDNLIVTPGGKQALYEIFQTVIDDGDE
710|gene|hut        DAGNTGYTPSDGIPELKDAIVEKLHADGLTQYESENVLVTPGGKQALYEVFQSLIDDGDE
713|hp|hut          ------------------------------------------------------------
4410|gene|nph       DAGHTGYPPSNGIPKLKEAIADKLDADGL-DYSTDEVIVTPGAKQALYETFQALVEDGDE
832|gene|hla        DAGHTGYTSSNGIPQLKEAIAAKLRDDGL-DADADEVIVTPGGKQALYETFQTLIDDGDE
1632|gene|hwa       DAGHTGYTPSNGIPELREAIAARLREGGI-DAIDEEIIVTPGGKQALYEAFQVLIDDGDE
21520|gene|hbo      DAGHTGYTSSNGIRELREAIAEKLRADGV-DADADEVIVTPGGKQALFETFQTLIDDGDE
                                                                                

1697|hp|hhi         ------------------------------------------------------------
629|gene|nrc1       VALLDPAWVSYEAMAKLAGGELNRVDLAPHDFQLEPALDDLADAVSDDTELLVVNSPSNP
11434|gene|hma      VALLDPAWVSYEAMAKLAGGTLTRVNTAAHDFQLEGALDDLADAVSDETELLVVNSPGNP
2018|gene|hhi       VALLDPAWVSYEAMAKLAGGTLTRVDTAAHDFQLEGALDDLADAVSDETELLVVNSPGNP
710|gene|hut        VCLLDPAWVSYEAMVKLAGGSLTRVDTAAHGFDLEPALDDLAATVSDDTELLVVNSPGNP
713|hp|hut          ------------------------------------------------------------
4410|gene|nph       VVLLDPAWVSYEAMAKMAGGDLSRVDLSGSSFQLEPALEDLAATVSDETELLVINSPSNP
832|gene|hla        VVLLDPAWVSYEAMAKLAGADLSRVDLAPHGFQLEPALDALAETVSDDTKLLVVNSPSNP
1632|gene|hwa       VVLLDPAWVSYEAMSRLAGGSLTRVDLEPYSFQLEPGLDDLEAAVSEETELLVINSPSNP
21520|gene|hbo      VVLLDPAWVSYEAMTKLSGGSLNRVDLAPYDFQLEPALDDLAEAVSNDTELLVVNSPSNP
                                                                                

1697|hp|hhi         -----------------HEHMVTAIRTTTFEEHSY-AVLPTMLPPLE-------------
629|gene|nrc1       TGAVYSRAAMEGVRDLAVDHDITVISDEIYQRVNY-GPAHVSLAGLDGMFERTVTINGFS
11434|gene|hma      HGAVYSRDALEGVRDLAVEHDITVISDEIYKEITYDGVEAVSLGTLEGMEDRTITLNGFS
2018|gene|hhi       HGAVYSREAMEGVRDLAVEHDITVISDEIYKEITYDGVEAISLGTLEGMEDRTITLNGFS
710|gene|hut        HGSVYSDAALEGVRDLAVEHDITVISDEIYKEITYDGREATSLGTLEGMADRTITLNGFS
713|hp|hut          ------------------------------------------------------------
4410|gene|nph       SGAVFSDAALEGVRDLAVDHDITVISDEIYDAITY-DTEQTSLGSLEGMADRTVTINGFS
832|gene|hla        TGAVFSETALEGVRDLAVEHDIAVISDEIYEQITY-DAEHVSLASLDGMADRTITINGFS
1632|gene|hwa       TGAVYTDAALEGVRDLAVEYDITVVSDEIYDKITY-GVEQTSLASLSGMGDRTITINGFS
21520|gene|hbo      TGAVYSDAALEGVRDLAVEHDITVISDEMYEQITY-GVEPTSLGSLDGMADRTVTVNGFS
                                                                                

1697|hp|hhi         ------------------------------------FIPTPAV-----------------
629|gene|nrc1       KAYSMTGWRLGYLAGPEALVDQAGKVQSHSVSSAANFIQRAGVEAIRHTDDAIDEMVAAF
11434|gene|hma      KAYSMTGWRLGYFAAPEELVSQAGKVHSHSVSCAVNFVQHAGVEAITNTDDAVEEMRQAF
2018|gene|hhi       KAYSMTGWRLGYFAAPEELVSQAGKVHSHSVSCAVNFVQHAGVEAITNTDDAVEEMRQAF
710|gene|hut        KAYAMTGWRLGYFAGPEELIEQAGKLHSHSVTCAVNFVQHAGVEALRNTDETIEEMRAAF
713|hp|hut          ------------------------------------------------------------
4410|gene|nph       KAYSMTGWRLGYLAAPEPLVEQAGKLHSHSVSSAANFVQHAGVEALRNTDDAVDEMRDAF
832|gene|hla        KAYSMTGWRLGYLHATDEFVGQAGKLHSHSVSCAVNFVQRAGVEALENTDESVTEMRDAF
1632|gene|hwa       KAYSMTGWRLGYVHAPSALIDQAAKLHSHSVSCAVNFVQRAGVEAIENTDDAVVEMRDAF
21520|gene|hbo      KAYSMTGWRLGYVHAPEELISQAAKLHSHSVSCAVNFVQRAGIEAITNTDDAVTEMRDAF
                                                                                

1697|hp|hhi         ------------------------------------------------------------
629|gene|nrc1       ESRRDLLVDLFAEHGTDVSTPDGAFYLM--LPVADDDQAWCQDALKDAHVATVPGSAFGA
11434|gene|hma      AERREFLMGLFEDHGVHVPEPQGAFYMMPEIAPDGDDTEWCDQAISEAQVATVPGTAFGT
2018|gene|hhi       AERREFLMGLFEDHGVHVPEPQGAFYMMPEIAPDGDDTEWCDQAISEAQVATVPGTAFGT
710|gene|hut        EQRRDMLVDLFAEHGKDVPEPEGAFYMM--LPVDGDDQDWAEKAVEEAHVATVPGSPFGT
713|hp|hut          ------------------------------------------------RVATVLGSAFGT
4410|gene|nph       EARRDMLIDLFADHGKEVPFPDGAFYMM--LPVDDDDQAWCEGALEDAHVATVPGSAFGT
832|gene|hla        RDRRDLLVDLFDEHGVDVDVGDGAFYMM--IPVDEDDQAWCEAAIEEASVACVPGSAFNA
1632|gene|hwa       RERRDMLAELFESHDVDVPIGDGAFYMM--LPVDNDDQAWCSGAIEDAHVATVPGSAFGS
21520|gene|hbo      RERRDMLVDLFAEHGVDVPVGDGAFYMM--LPVDEDDAAWCEGAIEDAHVATVPGSAFGS
                                                                                

1697|hp|hhi         ----------------------------
629|gene|nrc1       PGYARLSYAASTDRLEAAVDRLAAEGYL
11434|gene|hma      PGYARISYANSKERLQEAVDRLAEADLI
2018|gene|hhi       PGYARISYANSKERLQEAVDRLAEADLI
710|gene|hut        PGYVRLSYAASRERLREAVERLAEADLL
713|hp|hut          PGYVRLSYAASRERLREGVERLAEADLL
4410|gene|nph       PGYARLSYAASEERLKTGVERLVDAGYL
832|gene|hla        PGHARISYAASEGRLREAVDRLVSNDLL
1632|gene|hwa       PGHARISYAASEDRLREAVGRLAEHEYI
21520|gene|hbo      PGYARISYAASEERLREAVERLAEHDYI