HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0192COG0079KOG0633arCOG04273Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylasehistidinol-phosphate transaminase

HOG Organism Gene ID Name Annotation
cHOG0192 nrc1 VNG1033 hisC1 histidinol-phosphate transaminase
cHOG0192 hmu HMUK2375 Hmuk_2375 histidinol-phosphate aminotransferase( EC:2.6.1.9 )
cHOG0192 hma RRNAC0529 hisC2 histidinol-phosphate aminotransferase
cHOG0192 hwa HQ3364A hisC histidinol-phosphate aminotransferase
cHOG0192 hla HLAC1343 Hlac_1343 nucleotide kinase
cHOG0192 hbo HBOR19300 Hbor_19300 histidinol phosphate aminotransferase apoenzyme( EC:2.6.1.9 )
cHOG0192 hut HUTA0367 Huta_0367 histidinol-phosphate aminotransferase
cHOG0192 hvo HVO_1295 HVO_1295 hisC histidinol-phosphate aminotransferase
cHOG0192 nph NP2140A hisC histidinol-phosphate aminotransferase 1
cHOG0192 hhi 1112 hisC1 histidinol-phosphate aminotransferase
MUSCLE (3.6) multiple sequence alignment


1343|gene|hla       -----------------------------------------MSGTERDEA--------DS
3364|gene|hwa       -----------------------------MQPRDLSAHEPYVPGRGTKEVARELEVDPDS
19300|gene|hbo      -----------------------------MQPRDLSAHEAYVPGRGAEEVARELGMDPEE
1033|gene|nrc1      MRTTHLNPMIPERRPREGILKDGPAVTPSMELRDLSDHVEYRAGRGIEEVARELGRDPSE
367|gene|hut        -----------------------------MDTRDLSSHTIYRAGRGIEETARELGVDPEE
2140|gene|nph       -----------------------------MQPRDLSHHVAYEAGRGIEEVARELGLDPDD
10529|gene|hma      -----------------------------MEPRDLSAHTVYRAGRGIEEVARELGLDPDD
1112|gene|hhi       -----------------------------MEPRDLSAHTVYRAGRGIEEVARELGLDPDD
                                                              .*   .*.        ..

1343|gene|hla       PIRVAVTGTPGTGKSTATALLADEYDVIH-------------LNDRIK-GDDDLWTERD-
3364|gene|hwa       LIKLSSNENPHGPSPAAVDAIADTAETVNTYPKSSHTDLTARIADYWGLSPEQIWLSPGA
19300|gene|hbo      LTKLSSNENPHGPSPDAVEAVEAAASEIHVYPKTSHADLTDALAERWDLTSEQVWVSAGG
1033|gene|nrc1      FVKLSSNENPHGPSPKATIAIREAATGVHRYPKAVHADLTGALADRWDVGDDQVWVANGG
367|gene|hut        LIKLSSNENALGPSPKAVEAIREHAEALHSYPKASHADLGEALAERWGVTPEQIWLANGG
2140|gene|nph       LVKLSSNENPFGPSPKAAEAIREHADRVNSYPKAAATDLRGEIGDLLSVDAAQVWLGNGG
10529|gene|hma      MVKLASNENMFGPSPDAVEAIRGSAERMHSYPKASHADLVDELADMWDVTPEQVWLSNGG
1112|gene|hhi       MVKLASNENMFGPSPDAVEAIRGSAERMHSYPKASHADLVDELAAMWDVTPEQVWLSNGG
                      .:: . .    .. *.  :      ::             :         ::*   . 

1343|gene|hla       -------------ADRDTLVADLD------AVREHLGDWS-----------GVLDSHLAH
3364|gene|hwa       DGAIDYLSRAFLTPGDTMLISDPGFSYYPMSARYHHGSIRTYPVSK-EQDFQQRASDILT
19300|gene|hbo      DGALDNLSRAFLEPDDRVLTPKPGFSYYAMSARYHHGEVAEYSLSK-ADDFAQTPETILD
1033|gene|nrc1      DGALDYLARATLDPGDSVLVPSPGFTYYGMSARFHHGNVAEYDVAEGADGFEMTADAVVD
367|gene|hut        DGAMDCLARAMIDPGQAALVPDPDFTYHSMSVRYHHGEVHTYPLVE-ADGFKQSPDRILD
2140|gene|nph       DGALDYLARAMLDPDDGVLVPDPGFAYYGMSARYHHGQVNSYPIEK-DDDFEQSPDAILE
10529|gene|hma      DGALDCLARAMLDPGQDVLVPSPGFAYYAMSARYHHGEVNEYTLSK-ADDFAQTADTVLK
1112|gene|hhi       DGALDCLARAMLDPGQDVLVPSPGFAYYAMSARYHHGEVNEYTLSK-ADDFAQTADTVLK
                                 ..   * .. .      :.* * *.                 . :  

1343|gene|hla       RFDVDRVVVLRCHPETIERRLRERGESDATAEENAESEALDVILSEAVAEHG--------
3364|gene|hwa       QYDDERLLYVTTPHNPSGSELPI--PEITALAEGVDDQTL-IVIDEAYGEYSNNPSAIKL
19300|gene|hbo      AYDGERIVYLTTPHNPTGSEMAR--EDIVTLLESVEDHTL-VVVDEAYGEYSEEPSAIGL
1033|gene|nrc1      AYDGERVVYLTTPHNPTGARFTL--DEIVAVADRTDEDTL-VLVDEAYGEFTETPSAVTL
367|gene|hut        AYDGERMIYLTSPHNPTGSTVSL--AEVEEIAERTDDGTL-VVVDEAYNEFADRPSAVEL
2140|gene|nph       SYDGERIVYLTSPHNPTGSEVSL--SDVEAVAEGTDEETL-VVVDEAYGEFADSPSAVAL
10529|gene|hma      DYDGERIVYLTSPHNPTGAEFTT--DAVRTIAEETDEQTL-VVVDEAYGEFTEKPSKRPL
1112|gene|hhi       DYDGERIVYLTSPHNPTGAEFST--DAVRTIAEETDEQTL-VVVDEAYGEFSDRPSKRPL
                     :* :*:: :    :.    .           : .:. :* :::.**  *.         

1343|gene|hla       -----------MDNVYEIDTTDRD-------------PESVAD--------------AIR
3364|gene|hwa       IQE--------YDNIAVLRTFSKAYGLAGLRIGYAAVPESWADAYARINTPFAANKTACQ
19300|gene|hbo      LDE--------YDNLAVIRTFSKAFGLAGLRIGYAAVPEAWADAYARVNTPFAASKVACR
1033|gene|nrc1      FDGQPAGGHAPRDDIAVLRTFSKAYGLAGIRLGYAVVPDSWADAYARVQTPFAASVIACQ
367|gene|hut        VEA--------RDDVAVVRTFSKVYGLAGLRLGYAITPAEWADAYERINTPFSASEIACR
2140|gene|nph       VEE--------RDDVAVLRTFSKAYGLAGVRLGYAVVPGEWADAYARVNTPFAASEIACR
10529|gene|hma      LSD--------RDDVALLRTFSKAYGLAGIRLGYAVVPEDWADAYARINTPFSASELACR
1112|gene|hhi       LDD--------RDDVALLRTFSKAYGLAGVRLGYAVVPEEWADAYARINTPFSASELACR
                                *::  : * ..              *   **              * .

1343|gene|hla       AAIE--------------------------------------------------------
3364|gene|hwa       AALAAIEDQSHVEHSIETARWAREHYREELDARTWPSGGNFVLCEVGDGNAVAEAAKQEG
19300|gene|hbo      AALAALGNEEHIEKSVETARWAREYYRDELNANTWPSGGNFVLVEVGDATAVAEATKRRG
1033|gene|nrc1      AGVAALDDDDHVEATTDSVAWGRDYIHDELAARTYESHGNFVLANVGDAGRVAEAAKREG
367|gene|hut        AGLAALEDDEHVDAITDLVEWGREYYYEHLDAKTYETGGNFVLVEVGDASRVAQATKERG
2140|gene|nph       AGLAALEDDAHVEKTVETARWAREYIRSTLECRTYESAGNFVLCAVGDGGEVAEAAQKEG
10529|gene|hma      AGLAALDDDEHVERSVDTAAWAREYLSAELDAPTWDSAGNFILAEVGDASAIADAAQERG
1112|gene|hhi       AGLAALDDDDHVERSVDTAAWAREYLSEELDSPTWDSAGNFILAEVGDASAVADAAQERG
                    *.:                                                         

1343|gene|hla       -------------------GDREPSAGTVDFMDYI----------------------
3364|gene|hwa       VIIRDTTSFGLPECVRISCGTREQTKRAVDIISAVIEDVETATTTTESGVETEVGRP
19300|gene|hbo      IIVRDTSSFGLPACIRVSCGTREETKRAVEVLNEVIADVEATKP-------------
1033|gene|nrc1      VLVRDCTSFGLPEHVRITIGTRSETERAVAVLNEVCDT-------------------
367|gene|hut        VIVRDCSSFGLPEHIRVSCGTREETRRAVETINEVL---------------------
2140|gene|nph       VIVRDTTSFGLPSCIRITCGTREETKRAVEVVNDLL---------------------
10529|gene|hma      VIIRDCSSFGLPECIRITCGTREDTERAVSVLNEVIEEVKA----------------
1112|gene|hhi       VIIRDCSSFGLPECIRITCGTREDTERAVSVLNEVIEVVEA----------------
                                       * *. :  :*  :. :