HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0191COG0046arCOG00641Phosphoribosylformylglycinamidine (FGAM) synthase synthetase domainphosphoribosylformylglycinamide synthase I

HOG Organism Gene ID Name Annotation
cHOG0191 nrc1 VNG0864 purL1 phosphoribosylformylglycinamide synthase I
cHOG0191 hmu HMUK1966 Hmuk_1966 phosphoribosylformylglycinamidine synthase II( EC:6.3.5.3 )
cHOG0191 hma RRNAC1390 purL phosphoribosylformylglycinamidine synthase II
cHOG0191 hwa HQ1693A purL phosphoribosylformylglycinamidine synthase, component II
cHOG0191 hla HLAC0214 Hlac_214 hypothetical protein
cHOG0191 hla HLAC0471 Hlac_471 phosphoribosylformylglycinamidine synthase II
cHOG0191 hbo HBOR22290 Hbor_22290 phosphoribosylformylglycinamidine synthase subunit II( EC:6.3.5.3 )
cHOG0191 hut HUTA0634 Huta_0634 phosphoribosylformylglycinamidine synthase II
cHOG0191 hvo HVO_1048 HVO_1048 purL phosphoribosylformylglycinamidine synthase II
cHOG0191 nph NP2982A purL phosphoribosylformylglycinamidine synthase, component II
cHOG0191 hhi 1965 purL phosphoribosylformylglycinamidine synthase II
cHOG0191 hhi 387 HAH_0387 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


214|hp|hla          ------------------------------------------------------------
387|hp|hhi          ------------------------------------------------------------
864|gene|nrc1       -------MSLGDSDRERVVAALGRDPTPAEAALFENLWSEHCAYRSSRSLLSAF------
634|gene|hut        -------MALSTSDRAVVVEKIDRDPTTAEAALFENLWSEHCSYRSSRPLLGRF------
1693|gene|hwa       -------MTLSDSDLELITTELGRELTPAEAALFENLWSEHCAYRSSRPLLQSFTTGDDS
471|gene|hla        -------MSLSEPDHELVVAELGREPTAAEVALFENLWSEHCAYRSSRPLLSAF------
11390|gene|hma      -------MSLSDADHELVVEEIGREPTRAEAALFENLWSEHCAYRSSRPLLSAF------
1965|gene|hhi       MGGHEEVMSLSDADHELVVEEIGREPTRAEAALFENLWSEHCAYRSSRPLLSAF------
22290|gene|hbo      -------MSLSDADRELVVAELGRDPTSAETVLFENLWSEHCAYRSSRPLLSAF------
2982|gene|nph       -------MSLSPSDRELVTEELGREPTPAEEALFENLWSEHCAYRSSQPLLSAF------
                                                                                

214|hp|hla          ------------------------------------------------------------
387|hp|hhi          ------------------------------------------------------------
864|gene|nrc1       --DSDSEAVVVGPGDDAAVVRVPGTD----------------QLVTVGVESHNHPSYVDP
634|gene|hut        --ESDGEHVVVPPGDDAGVVALPEDEN---------------TYLAMGIESHNHPSYVDP
1693|gene|hwa       ANDEGAEHVVIGPGDDAAVVRLPRVDEASETP----------IYITMGIESHNHPSYVDP
471|gene|hla        --ESEGDQVVVGPGDDAAVLALPEPDAADTPAAERDADDYGDQYVTFGVESHNHPSFVDP
11390|gene|hma      --DSEGDQVVIGPGDDAAVVSLPSHGDGEE------------MYITMGVESHNHPSYVDP
1965|gene|hhi       --DSEGDQVVIGPGDDAAVVSLPSHGDGEE------------MYITMGVESHNHPSYVDP
22290|gene|hbo      --SSEGDQVVVGPGDDAAVVRLPSYDAAEASDETDSDDAETETYITMGIESHNHPSYVDP
2982|gene|nph       --ESEGDRVVVGPGDDAAVVALPDPETGENSD----------TYITMGIESHNHPSYVDP
                                                                                

214|hp|hla          ------------------------------------------------------------
387|hp|hhi          ------------------------------------------------------------
864|gene|nrc1       YDGAATGVGGIVRDTLSMGAYPIALADALYFGDFDDEHARYLLDGVVEGISDYGNAIGVP
634|gene|hut        YDGAATGVGGIVRDILSMGAFPIALTDSLYFGNFDREHSRYLLEGVVEGISDYGNSIGVP
1693|gene|hwa       YDGAATGVGGIVRDTLSMGAYPIALADSLYFGSFDRERTQYLLDGVVEGIADYGNAIGVP
471|gene|hla        VDGAATGVGGIVRDTMSMGAYPIALLDSLYFGGFDRERSRYLFEGVVEGISHYGNCIGVP
11390|gene|hma      FDGAATGVGGIVRDTLSMGAYPIALADCLYFGDFDREHSRYLFEGVVEGISHYGNCIGVP
1965|gene|hhi       FDGAATGVGGIVRDTLSMGAYPIALADCLYFGDFDREHSRYLFEGVVEGISHYGNCIGVP
22290|gene|hbo      YDGAATGVGGIVRDTLSMGAYPIALADSLYFGDFDREHSRYLLEGVVEGIADYGNAIGVP
2982|gene|nph       FDGAATGVGGIVRDTMSMGAYPIALADSLYFGDFDREHSKYLFEGVVEGISHYGNCIGVP
                                                                                

214|hp|hla          ------------------------------------------------------------
387|hp|hhi          ------------------------------------------------------------
864|gene|nrc1       TVAGATQFHDGYTGNPLVNVACVGLVTEDRLVTAAAKSPGNKLVLVGNATGRDGLGGASF
634|gene|hut        TVAGSVAFHEDYEENPLVNVACVGMLSADRLITAEAQAAGNNLVLVGASTGRDGLGGASF
1693|gene|hwa       TVAGSVEFHNKYTGNPLVNVACIGLLTDERLVTAEAQSPGNKLVLVGNATGRDGLGGASF
471|gene|hla        TVGGSVAFHDGYEGNPLVNVACVGLTNEDRLVTATAQEPGNTLMLVGNGTGRDGLGGASF
11390|gene|hma      TVTGSVAFHDDYEGNPLVNVSCIGLLEPERTITAEAQEPGNKLVLVGNATGRDGLGGASF
1965|gene|hhi       TVAGSVAFHDDYEGNPLVNVSCIGLLEPERTITAEAQEPGNKLVLVGNATGRDGLGGASF
22290|gene|hbo      TVAGSVEFHENYEGNPLVNVACVGLLDADRLVTAEAQSAGNKLVLVGNATGRDGLGGASF
2982|gene|nph       TVTGSVAFHDDYEGNPLVNVACVGLTDDERLVTAEAQTPGNKLVLFGNATGRDGLGGASF
                                                                                

214|hp|hla          ------------------------------------------------------------
387|hp|hhi          ------------------------------------------------------------
864|gene|nrc1       ASEDLAEDAETADRPAVQVGDPYTEKLLIEANETLLDRDLVVAARDLGAAGLGGASSEMV
634|gene|hut        ASEDIAEDAETEDRSAVQVGNPYREKLLIETNEALIEEDLVESARDLGAAGLGGASSELV
1693|gene|hwa       ASEDLSEDAETEDRPAVQVGDPYTEKRLIEANEELITAELIQSARDLGAAGLGGASSELV
471|gene|hla        ASEDLAEDAETEDRPAVQVGDPYAEKRLIECNEALVDEDLVLSARDLGAAGLGGASSELV
11390|gene|hma      ASEDLAEDAETEDRPAVQVGDPYSEKLLVECNEALLDEELVESARDLGAAGLGGASSELI
1965|gene|hhi       ASEDLAEDAETEDRPAVQVGDPYAEKLLVECNEALLDEELVESARDLGAAGLGGASSELV
22290|gene|hbo      ASEDLAEDAETEDRPAVQVGDPYSEKLLIEANEELVEANLVEAARDLGAAGLGGASSELV
2982|gene|nph       ASEDLDEDAETEDRPAVQVGDPYAEKRLIEANEELVDDSLVRAARDLGAAGLGGASSELV
                                                                                

214|hp|hla          -----------------------------MTQSRFRT-----------------------
387|hp|hhi          --------MGLTVVRQREPPM---------SDGRYCRQVAPADVAP--------------
864|gene|nrc1       AQGELGARITLDAVHQREPEMNAMEILLAESQERMCYEVAPADVDAVREVATRYDLGCSV
634|gene|hut        AKGGFGAAIDLDDVPQREPNMNATEILLSESQERIVYEVTDENVERVQELAARYDLEAAV
1693|gene|hwa       AKGGLGARINLERVHQREPAMNAMEILLAESQERMCYEVHPDDVETVGDIAAKYDLGYAV
471|gene|hla        AKGGLGARLDLDSVHQREPNMNAMEILLAESQERMCYEVAPEDVARVEALAERFDLGCSV
11390|gene|hma      AKGGLGARIELDRVHEREPNMNAMEYLLAESQERMVYEVAPEDVDRVAELAERFDLGCSV
1965|gene|hhi       AKGGLGARIELDRVHQREPNMNAMEILLAESQERMVYEVAPENVDRVAELAERYDLGCSV
22290|gene|hbo      AKGGFGAEIELDRVHQREPNMSALEILLAESQERMCYEVREENVEQVADIAEKYDLGCSV
2982|gene|nph       AKGGLGAHIELDRVHQREPNMNALEILLAESQERMCYEVRPEDVDAVAAVADKYDLGCSV
                                                  :: *                          

214|hp|hla          ---------AFFAAIMA-------------------------------------------
387|hp|hhi          ---------ELIVLSSG-------------------------------------------
864|gene|nrc1       IGEVTT-G-NYVCEFDG-----------------ETVVDAPATVLADGAPATDQPSTVPQ
634|gene|hut        IGEVTE-DPNYTCTLDG-----------------EVAVDVPAEFVGEGAPLADLDTVEPE
1693|gene|hwa       IGEIRD-G-NYVCTFGD-----------------ETVVDVPAGFLADGAPMNDLSATEPP
471|gene|hla        IGEVTD-G-NYVCEFAGAGK--GEDDADDSDAESEVVVDVDAEYLADGAPMNDLASESPT
11390|gene|hma      IGELTEPGTNYVCTFEG-----------------ETVVDVDAAFLGDGAPMNDLPSDAPP
1965|gene|hhi       IGELTEPGTNYVCTFEGSETTVSDKSSGQRPRDSETVVDVDAEFLGEGAPMNDLPSDAPP
22290|gene|hbo      IGEVAE-G-NYVCTFEG-----------------ETVVDVPPEFLADGAPMNDLGSSEPE
2982|gene|nph       IGDVTD-G-NYVCTFDG-----------------ETVVDCDAEYLADGAPMNDLDHVEPT
                                                                                

214|hp|hla          ------LPTVA-------------------------------------------------
387|hp|hhi          --DRG-LPVDE-------------------------------------------------
864|gene|nrc1       APATD-RPDPA--LGTAIDAVLSAPNTASNEWVYRQYDHEVGARTVQRPGEDAAGLALHE
634|gene|hut        QPDED-RPDVD--LEDAVETVLASPNTASKRWVYRQYDHEVQVRTAMRPGDDAALLAIRE
1693|gene|hwa       TPEESTFPAID--AATAFNTIISTPNTASKRWIYRQYDHEVGLRTAMRPGDDAALIAIRE
471|gene|hla        QPDRD-LPDPEPSLDEAVESVVSAPSTASKRWVYRQYDHEVGVRTAMKPGDDAAIMAIRE
11390|gene|hma      KQERD-LPTVS--LDEAFERIVSSPNCASKRWVYRQYDHEVQVRTSVLPGDDAALLAIRE
1965|gene|hhi       KQERD-LPTVS--LDEAFEQIVGSPNCASKRWVYRQYDHEVQVRTSVLPGDDAALLAIRE
22290|gene|hbo      QPSRD-LPDTD--LTEAFEAVVGAPNTASKRWVYRQYDHEVGLRTAVRPGDDAAVMAIRE
2982|gene|nph       QPDRD-RPSPD--LETAFEAVVAAPNTASKEWVYRQYDHEVGTRTALKPGDDAALMAVRE
                           *                                                    

214|hp|hla          ----------------------------------------------STEAAGAAPI----
387|hp|hhi          ---------------------------------------------TRLVTDGG-------
864|gene|nrc1       A-----------DDGTTVALSAGANPGWTACQPYAGAYATAVENATNLAAAGAEPLAAVD
634|gene|hut        A-----------ETDTALAISAGADPNWTDTAPYEGAFAAGLENATNIAAKGATPLAAVD
1693|gene|hwa       A-------------GVGLALSSGAVPAWTESNPYKGAQAVALENATNVAAKGATPIAAVD
471|gene|hla        TASTDAADLAPADQGVGLALSSGANPNWTETDPYEGARAVALENATNLAAKGAVPLAAVD
11390|gene|hma      A-------------GTGLAFSAGADPNWTDAAPYEGARAVALENATNVAAKGATPHAAVD
1965|gene|hhi       A-------------GTGLAFSAGADPNWTDAAPYEGARAVALENATNVAAKGATPHAAVD
22290|gene|hbo      A-------------NAGLAISSGANPNWTTCAPYDGARAVALENATNLAAKGATPLAAVD
2982|gene|nph       A-------------GVGLAFSSGADPNWTDTAPYDGARAVALENATNIAAKGALPLAAVD
                                                                     : *.       

214|hp|hla          -------EEPNLF-----------------------------------------SLTTLG
387|hp|hhi          -----------------------------------------------GPIPGVP------
864|gene|nrc1       CLNGGNPEDPDVYGGFEAMVAGLADGCRAIDTPVVGGNVSLYNDSATGPIAPTPTLAVVG
634|gene|hut        CLNAGNPEKPEVYGEFSGIVDGLADACADLSVPVVGGNVSLYNDSSTGPIAPTPTLTMVG
1693|gene|hwa       CLNGGNPEKPAVYGAFKDIVQGLADMCHTLSIPVVGGNVSLYNDSTSGPIPPTPTLALVG
471|gene|hla        CLNGGNPEKPEVYGGFKGIVDGLADACADLDAPVVGGNVSLYNDSVEGPIPPTPTLALIG
11390|gene|hma      CLNGGNPEKPDVYGGFKGIVDGLADMCSDLDVPVVGGNVSLYNDSQDGPIPPTPTLALVG
1965|gene|hhi       CLNGGNPEKPDVYGGFKGIVDGLADMCSDLDVPVVGGNVSLYNDSQDGPIPPTPTLALVG
22290|gene|hbo      CLNGGNPEKPDVYGGFKGIVDGLADMCRDLSVPVVGGNVSLYNDSVSGPIPPTPTLAVVG
2982|gene|nph       CLNGGNPEKPDVYGGFRGIVNGLADMCSTLDVPVVGGNVSLYNDSPSGPIPPTPTLAMTG
                                                                                

214|hp|hla          ----------------AVIGAFLIA-----------------------------------
387|hp|hhi          ------------------------------------------------------------
864|gene|nrc1       YRDQHPVPGSGL----AGDGDLVLVGGH------ADGLGGSVYLQALGGTDQFPAADA--
634|gene|hut        TKPGFSAPPMSL----SGEGTLVLVGDLAIGGDTDPRLGGSELLAEKGGSDRFPELPDDP
1693|gene|hwa       TKKTFDAPPAAL----TGDGTLLLVGHQ------SNNLGGSELLAQIGGTDKFPALPSNP
471|gene|hla        TRKGYNAPPAALDADSAGDSELLLIGAGGAD---GGALGGSEYLAQAGGTDRFPTLPDTE
11390|gene|hma      VKEGYDAPPLSL----SGEGRLVVVGDTALEGKTDPRLGGSEYTAQFGGTDRFPALPVDS
1965|gene|hhi       VKEGYDAPPLSL----SGEGTLVVVGDTALEGEADPRLGGSEYTAQFGGTDRFPALPADS
22290|gene|hbo      TKAGYDAPPAAF----AGEGELLVVGAS------GGALGGSEYLAQMGGSDAFPELPENA
2982|gene|nph       TKPGYDAPPAAL----SGDGDLLVVGDGG-----DLELGGSELLAQFGGSDQFPALPDSP
                                                                                

214|hp|hla          -----LLIVAAVRHADR-------------------------------------------
387|hp|hhi          ----------------------------------------DDGGDNYGC-----------
864|gene|nrc1       -----AGVDAVREAATRADTLAVHDISDGGLAVTLAEMVTADAGATVTV----PGLAA--
634|gene|hut        S----GFIETLADVADHEDTLAVHDASHGGLAVTLAEMVHDDAGAAVTI---DAADPVGA
1693|gene|hwa       T----AVVDSLARVANHPSTLATHDVSTGGLAVTLAELITSDAGARVTV------QNKTS
471|gene|hla        TKSLADRVASLAAVARHESTFATHDVSDGGLAVALAELVTDAAGADVTL----PDRVA--
11390|gene|hma      T----DVVETIAEVADADHVLASHDVSHGGLAVTLAEMVHEDAGASVEIGTTEHGTPARL
1965|gene|hhi       T----DVVETIVEVADADHVLASHDVSHGGLAVTLAEMVHEDAGASVGIGTTEHGTPARL
22290|gene|hbo      S----DVLATLADVADAETTLAVHEVNHGGLAVSLAEMVTDDAGADVTV------ESVSA
2982|gene|nph       A----AFIEAVADIADLDSTHATHDVSHGGLAVALAELV-GDAGADVDLAGSPDALSV--
                                                                                

214|hp|hla          ------------------------------------------------------------
387|hp|hhi          --------------------------------GSSRGHG--------------------D
864|gene|nrc1       LFSECPGRAVVETRDADALQAALD--VPVVRLGSATTDGTLSVTVDDE-------TVTRD
634|gene|hut        LCHEQPGRAVIETTDPAAIEDAFDGVAPVVEIGEADASESLDLTVGEE-------SLSYD
1693|gene|hwa       LFTETPGRAVIETTDPDAVRHIFEGVAPVVSLGDTTTDGTLTINIDDEDTANESPAVTTD
471|gene|hla        VFEETPGRLVVQTTDPEAVAE-LAGELPVLRLGEVTTDGALSLSVGDD-------ETAFD
11390|gene|hma      LFNERPGRVVFETTDPAAVREAFDGVAPVTELGEANDSNGLDITVNDE-------TLAYN
1965|gene|hhi       LFNERPGRVVFETTDPAAVREAFDGVAPVTELGEANDSNGLDITVNDE-------TLAYN
22290|gene|hbo      LFDETPGRAVVETTDADAVREAFDGVAPVTTLGKATEDGTLSLSVEGN-------ELDYG
2982|gene|nph       LFSEAVGRVVVETTDPEAVKERLDGVAPVEHIGHATDSGRLELSVGDE-------TLSYS
                                                                                

214|hp|hla          ----------------
387|hp|hhi          AAHCVQVMTLLNGD--
864|gene|nrc1       AATIRDHRGVIARELD
634|gene|hut        TGAIADLRSVLEDELD
1693|gene|hwa       AATVAKQRRILEDALE
471|gene|hla        ADTIRELRGVIDRELA
11390|gene|hma      VADIADLRSVIDDEL-
1965|gene|hhi       AADIADLRSVIDDELA
22290|gene|hbo      VEEIADLRDVLAQELD
2982|gene|nph       AADIASLRSVIGETLE