HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0019COG1058KOG2644arCOG00215Predicted nucleotide-utilizing enzyme related to molybdopterin-biosynthesis enzyme MoeAcompetence-damage protein CinA-like

HOG Organism Gene ID Name Annotation
cHOG0019 nrc1 VNG0761 dip3 competence-damage protein CinA-like
cHOG0019 hmu HMUK2333 Hmuk_2333 molybdopterin binding domain
cHOG0019 hmu HMUK0932 Hmuk_0932 molybdopterin binding domain
cHOG0019 hma RRNAC0822 mogA molybdenumm cofactor biosynthesis protein
cHOG0019 hma RRNAC2608 dip3 competence-damage protein CinA-like
cHOG0019 hwa HQ2043A cinA CinA-like domain-containing protein
cHOG0019 hwa HQ2488A cinA CinA-like domain-containing protein
cHOG0019 hla HLAC1922 Hlac_1922 molybdopterin binding domain protein
cHOG0019 hla HLAC1711 Hlac_1711 molybdopterin binding domain protein
cHOG0019 hbo HBOR20630 Hbor_20630 competence/damage-inducible protein cinA
cHOG0019 hbo HBOR28890 Hbor_28890 predicted nuleotide-utilizing enzyme, moeA-like
cHOG0019 hut HUTA0288 Huta_0288 molybdopterin binding domain
cHOG0019 hvo HVO_0286 HVO_0286 dip competence-damage protein CinA-like
cHOG0019 nph NP4100A cinA_1 CinA-like domain-containing protein
cHOG0019 nph NP5148A cinA_2 CinA-like domain-containing protein
cHOG0019 hhi 3029 HAH_3029 competence-damage protein CinA-like protein
cHOG0019 hhi 1462 mogA molybdenumm cofactor biosynthesis protein/molybdopterin binding domain-containing protein
MUSCLE (3.6) multiple sequence alignment


28890|hp|hbo        ----------------MNVAIVTVGNELLAGDIENTNATWLARELTERGVKVARVITIPD
761|gene|nrc1       ----------------MQVALVTVGDELLAGDTVNTNAAWLGQQLHERGATVARTIVIPD
288|gene|hut        MTEGRHLFVRPVPTSGMRVGLITVGDELLAGDTVNTNAAWLAEQLTDRGVTVGRITVVPD
10822|gene|hma      ----------------MRVAVVTVGDELLSGKTVNTNAAWLGQQLAERGVTVGRTTVVPD
1462|gene|hhi       ----------------MRVAVVTVGDELLSGETVNTNAAWLGQQLAQRGVTVGRTTVVPD
4100|gene|nph       ----------------MNVALVSVGDELLSGDTVNTNAAWLGERLTERGASVARVTVVPD
1711|gene|hla       ----------------MDAAIVTVGDELLVGDTENTNATWLCGRLADRGVTVRRVTVVPD
2488|gene|hwa       ----------------MRVAVVTVGDEILAGDTINTNAAWLCEQLTDHGVTVERITTVPD
20630|gene|hbo      ----------------MRIAVVTVGDELLAGDTVNTNASWLAERLTARGVRVERVTTVPD
12608|gene|hma      ----------------MEVALLTVGDELLAGDTENTNASWLGRQLTAAGASVTRVLTIPD
3029|gene|hhi       ----------------MEVALLTVGDELLAGDTENTNASWLGRQLTAAGASVTRVLTVPD
2043|gene|hwa       ----------------MRVAVLTIGDELLAGDTTNTNATWLAQRLTERGVTVRRILTVPD
5148|gene|nph       ----------------MDAALVTVGDELLAGDTENTNATWLAGRLSDRGVAVKRTLVVPD
1922|gene|hla       ----------------MEVALITVGDELLAGDTVNTNANWLAAELSDRGVAVKRILSVPD
                                    *  .::::*:*:* *.  **** **   *   *. * *   :**

28890|hp|hbo        EETTIAETVGEWSMSFDAVVVTGGLGGTPDDLTMPGVAAGLDRELAVDPVAAADVEATID
761|gene|nrc1       EVATIQADVAALSERYDAVIVTGGVGPTHDDVTMDAVASAFDRELTEHADAVAYFQRHDT
288|gene|hut        RTADIAETVDAYRTQYDAVLLTGGIGPTHDDVTMEAVAEAFDVALVEDQAALDWLAENRD
10822|gene|hma      EISDIARVVNEYHAEFDAVIVTGGLGPTHDDKTIEAVAAAFGRDVVESEDAIAWLEEHGG
1462|gene|hhi       EISDIARVVNEYHAEFDAVIVTGGLGPTHDDKTIEAVAAAFGRDVVESEDAIAWLEEHGG
4100|gene|nph       RVADIARVVNEHAADYDAVIVTGGIGPTHDDKTMEGVAAAVGRSLSRNEAALEWLESAGG
1711|gene|hla       EVAEIARVVNEYYAEYDAVLVTGGLGPTHDDVTMEAVAAAFGRDLVANDQAADWLAER-G
2488|gene|hwa       TVSDIARVVNEYHAECDAVIVTGGLGPTHDDVTMEGIAAAVGRSVEPHDAAKEWLSAEKG
20630|gene|hbo      RVAEIARVVNEYRAEYDAVIVTGGLGPTHDDLTMAGVAAAVGRELVEHEAALEWLTEHGG
12608|gene|hma      DEAVIADAVARYHDAFDAVIVTGGIGGTPDDITKAAVARAFGRDLVVPDDVRAHLEAKAE
3029|gene|hhi       DEAVIADAVARYHDAFDAVIVTGGIGGTPDDITKAAVARAFGRDLVVPDDVRAHLEAKAE
2043|gene|hwa       EHSLIRSRVREYSGNFDAVIVTGGIGSTPDDVTVDAVADAFDRNLVISEQARADVIETLE
5148|gene|nph       VRAVIADAVGRYSDAFDAVLVTGGLGRTPDDVTVEAVADAFDRGLVVDEVALADVERTLE
1922|gene|hla       DRAVIAECVRAYADAFDAVIVTGGLGGTPDDVTLEAVADAFDRELVPTDLTREAVERRLA
                      : *   *       ***::***:* * ** *  .:* ...  :     .   .     

28890|hp|hbo        RILERKPDI----EFDLKVEWYASMPAGATPIPNPEGLAPGCVAENVYVLPGIPEEMRAV
761|gene|nrc1       YSAADLT------------TGTTHLPAGARLLENPRGVAPGAAVNNVYVLPGVPDEMKGM
288|gene|hut        YAREDLA------------DGTALIPAGARMIPNREGVAPGCVLANVYVLPGVPAEMQAM
10822|gene|hma      YTRDDLT------------DGTGEVPEGSRVLPNHEGVAPGCVVESCYVLPGVPGEMKRM
1462|gene|hhi       YTREDLT------------DGTGEVPEGSRVLPNHEGVAPGCVVESCYVLPGVPAEMKRM
4100|gene|nph       YAREDLT------------EGTTLLPADAEPLHNTEGVAPGCKVENVYVLPGVPAEMKAM
1711|gene|hla       YSADDLV------------AETTHLPADCRPLANEAGVAPGAVVESVYVLPGVPAEMEAM
2488|gene|hwa       YASDDLA------------DGTTALPARARMLPNEVGVAPGAVVESIYAFPGVPAEMQAM
20630|gene|hbo      YAAAELS------------EGTTDLPARARMLPNEVGVAPGAVVEDIYVLPGVPEEMKAM
12608|gene|hma      RFADDNPKMVDRYDMDLDLDAWASVPEGGQALLTDESFAAGCVIDRVYVLPGIPEELKAM
3029|gene|hhi       RFADDNPEMVDRYDMDLDLDAWASVPEGGQALLTDESFAAGCVIDRVYVLPGIPEELKAM
2043|gene|hwa       ALSDTVP------NIDVDIDAEATIPEDARPLLNTEGLAPGCVVENVYVLPGIPSELKTM
5148|gene|nph       AIAGEYP------DLEVDAAAEARLPRGSRPLINHAGLSPGCVVDNVYVLPGIPSEMERM
1922|gene|hla       EIRERLPDS----DVNVDVEAEAAVPEGSRPLLNDSGLAPGCVVEGVYVMPGIPEELKAM
                                            :*     : .  ..:.*.     *.:**:* *:  :

28890|hp|hbo        FDNVADDFGGTVA-TTTFYTPEPEGAMAEPLATVATEFGVRVGSYPNRNGARTRVKLTAT
761|gene|nrc1       FETVADEFTGEQVYTEEVSVDAPESALIDTIAALQEAYDVTVGSYP---GDRVRVKIQHS
288|gene|hut        FDVVATDFTGEQQHIEVVHVDEPESALLDRIETLGDRFDVTVGSYP---GEIVRLKISST
10822|gene|hma      FEEVAEEFAGEQRYVRTVDAAEPESALLDRLAEVQEQFPVKVGSYP---GEHVTVRFEGT
1462|gene|hhi       FEEIAGEFAGEQRYVRTVDADEPESALLDRLAEVQEQFPVKVGSYP---GDHVTVRFEGT
4100|gene|nph       FESVADDFDGEPPHVGYVAVNEPESQLVDRLQELQERFAVTVGSYP---GEHVRVKIEST
1711|gene|hla       FESVVEEFEGTPTHTVVVDVDEPESELLERFTELQETFDVTVGSYP---GESVRVKITAA
2488|gene|hwa       FESVAAEFSGEQTVTEIVAIDEYESELIDRIADLREQFAVTVGSYP---GDCVRVKLTST
20630|gene|hbo      FERIESEFNGETTYTETVRTVEPESELVGRLHDVQEMFDVTVGSYP---GDDVRLKLTAN
12608|gene|hma      YETIADEFDGDRT-TETIHTPAPEGALVTHITAAREQFEVAVGSYPRKDDAPGRVKITGD
3029|gene|hhi       YETVADEFDGDRT-TETIHTPAPEGALVTHITAAREQFAVAVGSYPRKDDAPGRVKITGD
2043|gene|hwa       FNKIAEEFTGEAV-SSVLYTVKPEANIVSALKTVGEEFDVTIGCYPDRNAGHNRIKVTAT
5148|gene|nph       FELVAEEFNGDTE-SRYLYTEEPEANLLDRLEDVRDRFGVAVGCYPDREAGHNRLQLKAT
1922|gene|hla       FASVADEFAGDRR-SRFLYTVEPESDIVPALEAAGEQFDVAIGCYPDREAEHNRLKVTAT
                    :  :  :* *       .     *. :   :      : * :*.**        :..   

28890|hp|hbo        DAAVLDEASSWLVENAGVELTETDGKKTDG------
761|gene|nrc1       DADTVRAAADWFRDR--VTAVSRE------------
288|gene|hut        DRDAVERATAWLRER--VELAAAEES----------
10822|gene|hma      EEELVEEAAAWFSER--VESPTAE------------
1462|gene|hhi       EEELVEDAAAWFGER--VESPTAE------------
4100|gene|nph       DAAAVNAAMAWLQDR--AEVEESD------------
1711|gene|hla       AADEAERAAEWVRER--SELVDSEN-----------
2488|gene|hwa       DPEAVAAARRWLTAR--VSLADTDDETA--------
20630|gene|hbo      DESELRDAAGWLEER--VEIADEAK-----------
12608|gene|hma      DPATVADAAAWLRDR--IETE---------------
3029|gene|hhi       DPATVADAAAWLRER--IEVVDIE------------
2043|gene|hwa       DGETLTSATTWLQNQ--IDASDTPVERDWGENVESD
5148|gene|nph       DPDALDDAASWLADT--LALVDPDDAA---------
1922|gene|hla       DEDALDEAAAWLLAN--VDASETPVRRDWGSE----
                           *  *.