HOG Organism Gene ID Name Annotation
aHOG1896 hbo HBOR05790 Hbor_05790 PEP phosphonomutase-like enzyme( EC:4.1.3.1,EC:2.7.8.23 )
aHOG1896 hla HLAC2153 Hlac_2153 isocitrate lyase and phosphorylmutase
aHOG1896 hwa HQ3094 aceA isocitrate lyase
aHOG1896 nph NP4432 prpB_2 carboxyvinyl-carboxyphosphonate phosphorylmutase
MUSCLE (3.6) multiple sequence alignment


2153|gene|hla      ----------MYPNELDDDVFTKDIDNPAGRRLRELFEEQDYTFAPGIYHALDARLAEMA
4432|gene|nph      MAHDNDGTDEVASRVQNTESIVRDVDNPAARELREKFEEQDFTFAPGLYHALDARLAEMA
5790|gene|hbo      ------MSEDPYERTTGADVFTRDVDNPSAREFRRMLDEQNFVFAPGIYHALDARLAELA
3094|gene|hwa      ----------MNPTELDDNVFNRDIDNPQGEKFRNQLNNQDFVFAPGMYHALDARIAEMT
                                   . : : .*:*** .  :*  :::*::.****:*******:**::

2153|gene|hla      GLDAAYMSGYSTVLGQFGFPDLEMVTMSEMVENAKRMVEATNLPVIADCDTGYGGTHNVR
4432|gene|nph      GLDAAYMSGYSTVLGQFGFPDLEMVTMTEMVENAKRIVEATNLPVVADCDTGYGGIHNVR
5790|gene|hbo      DLDAAYMSGYSTVLGQFGFPDLEMVTMTEMVENAKRIVEATNLPVIADCDTGYGGVHNVR
3094|gene|hwa      GHDAAYMSGYSTVLGQFGFPDLEMVTMTEMVENAKRMAEATNLPIIADCDTGYGGIHNVR
                   . *************************:********:.******::********* ****

2153|gene|hla      RAVREYEKAGVAAIHIEDQTTPKRCGHIAGKEVVSQEQARSRFEAAVDAKQSEDTVIIAR
4432|gene|nph      RAVREYEKAGVAAVHIEDQTTPKRCGHIAGKKIISREDAEARFSAAVDAKQSEDTIIIAR
5790|gene|hbo      RAVREYEKAGVAAIHIEDQTTPKRCGHIAGKQIISRDKARARFEAAVDAKQSEDTFIIAR
3094|gene|hwa      RAVREYEKAGVAAVHIEDQTTPKRCGHIAGKQIIPREKAEARFTAAVDAKQSEDTVVIAR
                   *************:*****************:::..:.* :** ***********.:***

2153|gene|hla      IDSYGSANGDWEDHLERGRIYADAGVDLVWPEMPDPSREDAIEYAETIHETHPDLDLAFN
4432|gene|nph      TDAYGSANGDWEEHLERGRIYADAGVDLVWPEMPDPSREDAVEYAETIHETHPELDLAFN
5790|gene|hbo      TDAYGSSNGDWEEHLERGRIYADAGVDMVWPEMPDPSREDAVNYAETIHETHPDLKLAFN
3094|gene|hwa      TDAYGSANGDWEEHLERGRMYADAGVDLVWPEMPNPSREDAVNYAETIHETHPDLKLAFN
                    *:***:*****:******:*******:******:******::**********:*.****

2153|gene|hla      YSSSFEWGAQEDPLTFEELGDLGYQYIFITLYGLHSGAHAAYEDFANIAENDEEAQFDLE
4432|gene|nph      YSSSFAWSEEEDALTFQELGDLGYQYIFITLYALHSGAHAVYEDMKNIEQNDEEAQWDLE
5790|gene|hbo      YSSSFAWSKEEDPLTFEELGDLGYEYIFITLFGLHSGAHSVYEDFRALAETDEEAQFDLE
3094|gene|hwa      YSSSFAWSEEDDPLTFQELGDLGYKYIFITLAGLHSGAHAVYEDFKKLAEADETGQFELE
                   ***** *. ::*.***:*******:****** .******:.***:  : : ** .*::**

2153|gene|hla      ERYIGHETESHHELSFVPRYQDIEAQFDPDASRRHEESAGFTDEESDPITTESNDDD
4432|gene|nph      GRYLGHETESHHELSFVSRFQDIEAQFDPEAKERMEKSAGFTEEESDPLTS---DGN
5790|gene|hbo      GRYLDHPTESHHELSFVSDYQETEMQFDGEARNRIENSEGFSEEESTPIES---DD-
3094|gene|hwa      DRYLEHPTESHHELSFVSRYQDIETKFDPEARRRIEQSEGFSDEETDPITS---DDD
                    **: * **********. :*: * :** :*  * *:* **::**: *: :   *.