HOG Organism Gene ID Name Annotation
aHOG1893 hbo HBOR09300 Hbor_09300 molybdenum cofactor synthesis domain
aHOG1893 hla HLAC1943 Hlac_1943 molybdenum cofactor synthesis domain protein
aHOG1893 hwa HQ3022 moaB molybdenum cofactor biosynthesis protein B
aHOG1893 nph NP4814 moaB_1 molybdenum cofactor biosynthesis protein B 1
MUSCLE (3.6) multiple sequence alignment


3022|gene|hwa      --MYRDTIPRATFQSHIRTD-GSGM--------DANSDTDHTHTEEHTENTNHSHHHGAG
4814|gene|nph      --------------MTDDTDTEHGD--------EGAVDEDNGTGGADETHRDHDGDDGHD
9300|gene|hbo      MSPNRAAVNEHGHGESDDTD-GHGDSDETGGHGESDDTDGHDNHDSHDNHGDHDHGHGHD
1943|gene|hla      --------------MSDAGD-GH----------------DHDHHDESDHNGQHDATHDGQ
                                      *                   .:        : :*.   .  

3022|gene|hwa      GDDDHDHNHTHHAHDVGTLGVAIFTVSSSRSLTDDAAGDAIVAAFESAGHTIITREIVDD
4814|gene|nph      HDDGHDHDH-HH-HDVDSLGVGLLTISSSRTIEEDGAGDAIAEAMADAGHEIAVRELVPD
9300|gene|hbo      GNDSHDH---HHAHDVETLGVAVVTVSSSRSIDEDTAGDALVDAFEGDGHEVTVRELVAD
1943|gene|hla      HDATHD-DHDHHDHDADSVAIAVVTVSSSRSLDEDPSGDHVVAAFEDADHETVVRELIPD
                    :  **    ** **. ::.:.:.*:****:: :* :** :. *: . .*   .**:: *

3022|gene|hwa      DVHRIQSVVETAVSDADTDIVVTTGGTGITPDDVTIEAVSDQYDKSLPGFGELFRRRSEA
4814|gene|nph      DYDRVQDTVDRFIGRDDVDCVVTTGGTGVTPDDVTIEAVEPLFDKRLPGFGELFRTLSYE
9300|gene|hbo      DFDGVQSTVNRLVDRDDVDAIVTSGGTGVTPDDVTVEAVTDIATKTLPGFGELFRRLSYE
1943|gene|hla      EYDSVQGTVDRLARRKDTDAVVTTGGTGVTPDDVTPEAVKGLFAKTLPGFGELFRRLSYE
                   :   :*..*:      *.* :**:****:****** ***     * *********  *  

3022|gene|hwa      EIGTRVLGTRATAGIIDAVPVFCLPGSENAATLGSTELIVPEAPHLAGLATRDET-----
4814|gene|nph      EIDTRVVGTRAVGGIADGAAVFCLPGSENAAQLGTEEIIVAEAPHLVGLAGR--------
9300|gene|hbo      EIGARVIATRSMAGIVDSTPVFCLPGSENAARLGAEEILVPELPHIAGLAGRE-------
1943|gene|hla      EIGTRTIGSRAIAGVVSATPVFCLPGSENAVRIGVDEVILPEIGHLVGLAGRGVEDAEEA
                   **.:*.:.:*: .*: ....**********. :*  *:::.*  *:.*** *        

3022|gene|hwa      ------------------------------
4814|gene|nph      ------------------------------
9300|gene|hbo      ------------------------------
1943|gene|hla      GDDVEGEIGGNGTKEGDDVETDDTETDDAE