HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0189COG0287KOG2380arCOG00245Prephenate dehydrogenasehypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0189 nrc1 VNG1235 vng1235 no entry
cHOG0189 hmu HMUK2357 Hmuk_2357 Prephenate dehydrogenase( EC:1.3.1.12 )
cHOG0189 hma RRNAC0512 tyrA prephenate dehydrogenase
cHOG0189 hwa HQ3352A tyrA prephenate dehydrogenase
cHOG0189 hla HLAC1779 Hlac_1779 prephenate dehydrogenase
cHOG0189 hbo HBOR19130 Hbor_19130 prephenate dehydrogenase( EC:1.3.1.12 )
cHOG0189 hut HUTA0273 Huta_0273 Prephenate dehydrogenase
cHOG0189 hvo HVO_1312 HVO_1312 Prephenate dehydrogenase
cHOG0189 nph NP3358A tyrA prephenate dehydrogenase
cHOG0189 hhi 1129 tyrA prephenate dehydrogenase
MUSCLE (3.6) multiple sequence alignment


1235|chp|nrc1       MEVLVVGAGAVGRWVAEVV-------AAPAAFADTDPQRAVAAADATENA----------
1779|gene|hla       MDILVVGAGEIGRWIADTVLADESPIDATVAFTDRDPAVADDAAAG-RDA----------
3358|gene|nph       MQLLVVGAGEMGQWFARHS------GADAVAFADRDSDTARRAAAGLNDA----------
273|gene|hut        MNVLVVGAGEMGRWVARTL-VADTTHSPDIAVTDLDSTAAQRAADA-VGG----------
10512|gene|hma      MNVLVVGAGAMGQWFARTV---RTHADAAVAFTDVDQSAAEAAANA-VGG----------
1129|gene|hhi       MNVLVVGAGAMGQWFARTV---RTHADAAVAFTDLDQSAAEAAADA-VGG----------
3352|gene|hwa       MEVLVVGAGEMGRWIARTL-----LQSFDIAFVDRDDAIAVAAAETIQRDADHASHNRTV
19130|gene|hbo      MEVLVIGAGEMGRWVGSTL-----TAEFDVAFADRDPDAARAAATS-TDG----------
                    *::**:*** :*.*..              *..* *   *  **                

1235|chp|nrc1       RAVAVDTAASFAVVAVAVPMRAAGAAIDAHAAAAERAIVDFTGVMGEPLAAMAAAGPPGV
1779|gene|hla       EAIPVDSDTTHDAVCLAVPMSAVPAAVEAYASRAERAILDVSGEMTDAIAAMREHAPDR-
3358|gene|nph       QAVPLDTDERFDVVCIAVPMSAVADAVAAHAGKATAAVVDVAGEMRDSVAALRKHAPDR-
273|gene|hut        RAVASETTERFELVCIAVPMPVTAEAIESYATNAEEAICDLAGIMAEPVEAMAEHAPDC-
10512|gene|hma      RAVASDAAETFDVVCIAVPMPVAETAIDEFAPCATDAIVDVTGSMAGPIAAMRDAMPDG-
1129|gene|hhi       RAVASDAAETFDVVCIAVPMPVAETAIHEFAPLATGAIVDVTGSMAGPVAAMQDAMPDG-
3352|gene|hwa       QAVTGDINATFSIVCLAVPITAVEPAIINYADRAEQAIFDITGVMQTPVEMMQAHCEHL-
19130|gene|hbo      RTVSLATEETFDAVCLAVPISAVDEAVFDHAPRAERAVFDVTGVMDAPVTAMREAAADR-
                     ::.      .  *.:***: ..  *:  .*  *  *: *.:* *  .:  :        

1235|chp|nrc1       ERASFHPLFAPAHAPGRIAVTDGDGGPTVDRLRGWLADAGNELVEVPAAVHDDAMETIQG
1779|gene|hla       ERASYHPLFAPPRVPGNVAAVVDEGGPVVEEITAAIEAGGNEVFETTPAEHDEAMETVQA
3358|gene|nph       ERASFHPLFSASNAPGNLPVVVDAEGPTVAALRAALSAAGNEVFETTPEEHDRAMETVQA
273|gene|hut        ERVSFHPLFAPANAPGNVPLVAAESGPVTDRVRNALTAAGNELFETTPAEHDAAMETVQA
10512|gene|hma      QRLSLHPLFAPENAPGNVAVVADALGPDATAVVDAIAAAGNNCFETTVSEHDEAMETVQA
1129|gene|hhi       QRLSLHPLFAPENAPGNVAVVNDASGPDAAAVVDALAEAGNNCFETTATEHDEAMETVQA
3352|gene|hwa       ERHSLHPLFAATNAPGNVAFVPDSPGPITNRIVDTVIEAGNHVFRTTPNEHDMAMQTVQA
19130|gene|hbo      ERLSLHPLFAAANAPGTVAAVRDAPGPVTERVCDTLSAAGNEVFETTPAEHDEAMETVQA
                    :* * ****:. ..** :. .    ** .  :   :  .**  . ..   ** **:*:*.

1235|chp|nrc1       RTHAAILAFALAADDVPDALATPVYEELSRLADRVTGGTPGVYADIQSTFGGSQEVAAAA
1779|gene|hla       GAHAAVLAWRLAGDDVREEFHTPVSAALDEVADTVTEGSPEVYAEIQRAFDGADDVAAAA
3358|gene|nph       QAHTAVLAYALAADDVDSRFHTALSEPLEALVDDVVGNTPEVYAEIQSRFDGSDAVAEAA
273|gene|hut        RTHAAILAFGLAAEPVPDRFQTPISAGLFDLLETVTDGEPRVYADIQAAFEGVDDVAAAA
10512|gene|hma      SAHAAVLAFAMAAADVPDQFQTPISAGLFDLVEQVTGGDSRVYADIQRTFDGADAVADAA
1129|gene|hhi       SAHAAVLAFAMAAADVPDRFQTPISAGLFDLVEQVTGGDPRVYADIQDAFDGADAVADAA
3352|gene|hwa       SAHAAVLAYALAAADVRDEFATPVSRALDDIVATVTDGTPRVYQEIQTTFRGADEVASAA
19130|gene|hbo      SAHAAVLAYALAAEDVREEFATPVSESLSSLVETVTGGTPRVYREIQESFPGADRVADAA
                     :*:*:**: :*.  * . : *.:   *  :   *. . . ** :**  * * : ** **

1235|chp|nrc1       DRIAAAAAGDGDAFAEVYEDAS--------------------------
1779|gene|hla       REIADS---DSEAFAALYERARGDREGRERHE----------------
3358|gene|nph       QRLADA---DASEFADLYEEAGR-------------------------
273|gene|hut        DRLANA---DDDGFEELYQAARPAQGTR--------------------
10512|gene|hma      SELADA---DADTFERLYEQLS--------------------------
1129|gene|hhi       RQIADA---DADTFERLYEQLS--------------------------
3352|gene|hwa       RQIADA---DSETFNQLYTEAGEHT-----------------------
19130|gene|hbo      TELASA---DAKTFEQLYRDASTRPDARDANPEPDAATELDSESEDDR
                      :* :   * . *  :*