HOG Organism Gene ID Name Annotation
aHOG1880 hmu HMUK2754 Hmuk_2754 glycosyl transferase group 1
aHOG1880 hut HUTA0539 Huta_0539 glycosyl transferase group 1
aHOG1880 hwa HQ2691 hexosyltransferase; glycosyltransferase
aHOG1880 nph NP1922 hexosyltransferase 3
aHOG1880 hma Hma_10429 lpg3 LPS glycosyltransferase
MUSCLE (3.6) multiple sequence alignment


1922|gene|nph       -------MSEP---------------DDVCVVTHPIGSASESHAETLLDILGAITDVSLV
2691|gene|hwa       MLIRPIYMTD----------------QGVCVITHPLGAAGENATRTLLDILAEVDSVSLV
539|gene|hut        -------MSD----------------SGVCVVTHPLSAAGENATRTLLDVLATLGPVALV
10429|gene|hma      -------MTEPTRHQEHETETQEADLPNVCVVTHPLAAAGENATRSLLDILSAITSVALV
                           *::                 .***:***:.:*.*. : :***:*. :  *:**

1922|gene|nph       AISVAEESPLREEYDTIEVSRVGTGGPIPIAALRFLANQVRMAMILRRRPEEVVLFFGVT
2691|gene|hwa       TADLPTNSSIHDNREVIELTQKGSGNSVLVAATRFLFNQLRMCAVIRQRPEDITLFFGAT
539|gene|hut        TADLPGDSSIRDDREVIELTEKGAGESVLVAAVRFLLNQLRMCAAIRRRPEDVVLFFGAT
10429|gene|hma      TADLPADSEIRDRHELVELTQKGAGDSVVIAAFRFLLNQLRMCRVIAGRDEDVVLFFGAT
                    : .:. :* :.:  : :*::  *:* .: :** *** **:**.  :  * *::.****.*

1922|gene|nph       AYLLPIVAAKLAGKTVVLQPRGNVPLTLRLHWERRLPDVLARGLAGVVWSMERLGYHAAD
2691|gene|hwa       AYVLPILFARAIGKTVLTEPRGDVPLTLQLNWEQRMPNTLARALANGVRLLEWIGFMTAH
539|gene|hut        SYLIPIAFARLIGKTVLVEPRGDVPLTLRLNWEQRMPDHLAGILAGSVRLLERAGFAIAH
10429|gene|hma      SYLLPIVVTRLLGKTVLVEPRGDVPLTLRLNWEQQLPDQVAAVLAGAVRALERAGFAVAH
                    :*::**  :.  ****: :***:*****.*:**..:*: :*  **. *. :*. *:  * 

1922|gene|nph       AIITYTPSMAEELGLDRFEEKLYPNGARYVDTDEFYPRVPFEERDRVVGFLGRLDEEKNV
2691|gene|hwa       TVITYTPNMARQVGLDPDSPSVYPHGARYIDTERFRPRTPFEKRDTLIGFVGRLDEEKGV
539|gene|hut        RVVTYTPNMARELGLDPDSPRVYPHGARYVDTAAFKPEVPFEERDDVVGFVGRLDEEKGI
10429|gene|hma      GVITYTPEMARQLDLHPESPSVYPTGARYVRTNEFCVQRPYADRDRVVGFLGRLDEEKGV
                     ::****.** ::.*   .  :** ****: *  *    *: .** ::**:*******.:

1922|gene|nph       RTLAAVAKELPEDVTFRFIGDGDLREELEEELAAEIEAGKVEFTGWVDHDEVPRQLSELR
2691|gene|hwa       RSLAAVAKQLPDGVTFRFVGDGPLYDWLEQELSEEIRAGQIELTGWVDHEDIPNELSQMR
539|gene|hut        RELVSVAKQLPGDVRFRFVGDGPLYEWVASELAEEIEDGSVELAGWVDHGDVPAELNRMK
10429|gene|hma      RELAAVATQLPDDITFRFVGDGDLREWLEEDLAADIEAGHVELTGWVDHDKVPHALNDLE
                    * *.:**.:** .: ***:*** * : : .:*: :*  * :*::***** .:*  *. : 

1922|gene|nph       LLVLPSEPTEGLPTVILEAMACGTPVLATPVSGVPDVVRQGETSFLMDEVAGEAIARDIE
2691|gene|hwa       LLIMPSEATEGLPTTILEAMACGTPVYASAVSGIPDVIQTGQTGWLIDNDDPQSMSDEIV
539|gene|hut        LLVMPSEPTEGLPTTILEALACGTPVYASPVSGVPDVVLEGETGFHIDSRDPDVLRSALE
10429|gene|hma      LLILPSQPTEGLPTTILEALACGTPVYASPVSGVPDVVRDEETGFTIDSRESTALAAGIE
                    **::**:.******.****:****** *:.***:***:   :*.: :*.     :   : 

1922|gene|nph       GILDRDDLTELSQYAREHIKAEYSFDAAVRRWRRVLEAL-----
2691|gene|hwa       AIINSTEIHIVSTKSREMICKQYSFEQAYNRYESLLSKI-----
539|gene|hut        SILLREDLVDISDRGRDLIVEEYRFEAACKRYRALLESVV----
10429|gene|hma      RILDRNDLAAISENGRTLIEREYSFDAACERYRGILRSVAGYSS
                     *:   ::  :*  .*  *  :* *: *  *:  :*  :