HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0187COG1009arCOG01539NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter MnhA subunitF420H2:quinone oxidoreductase chain L

HOG Organism Gene ID Name Annotation
cHOG0187 nrc1 VNG0646 nuoL F420H2:quinone oxidoreductase chain L
cHOG0187 hmu HMUK1925 Hmuk_1925 proton-translocating NADH-quinone oxidoreductase, chain L( EC:1.6.5.3 )
cHOG0187 hma RRNAC1455 nuoL2 NADH dehydrogenase I L subunit
cHOG0187 hwa HQ1646A nuoL NADH dehydrogenase, subunit L (ubiquinone)
cHOG0187 hla HLAC0712 Hlac_712 proton-translocating NADH-quinone oxidoreductase, chain L
cHOG0187 hbo HBOR21390 Hbor_21390 NADH dehydrogenase subunit L( EC:1.6.5.3 )
cHOG0187 hut HUTA0694 Huta_0694 proton-translocating NADH-quinone oxidoreductase, chain L
cHOG0187 hvo HVO_0986 HVO_0986 nuoL quinone oxidoreductase ( F420H2) chain L
cHOG0187 nph NP2310A nuoL NADH dehydrogenase-like complex, subunit L
cHOG0187 hhi 2036 nuoL NADH dehydrogenase subunit L (ubiquinone)
cHOG0187 hhi 692 HAH_0692 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


692|hp|hhi          ------------------------------------------------------------
2310|gene|nph       MDLIYQLTPAIVLVPLATFIISLVFG----QWMPKKGAIAGIFATAATLGLSVVTLGWLV
694|gene|hut        MTGIFDFAPAIALLPLAAFVVVLLGG----NYLPKRGALAGIAALGGSLVLSA----LSL
712|gene|hla        MIDVFSYVPAIVLLPFFSFLIALGVG----KYLPKGGAFGGIAATAGSFLLSL----WVL
11455|gene|hma      -MAAFTYAPAIVLLPFVSFLVALFAG----DRMPKGGALAGITATGGSLLLSI----WVA
2036|gene|hhi       -MAAFTYAPAIVLLPFVSFLVALFAG----DRMPKGGALAGITATGGSLLLSI----WVA
646|gene|nrc1       MAGALEFIPAIPLLPFASFLVALLAGYFAPKLLPKGGAIPGIVATAGSLVVSV----WAF
1646|gene|hwa       MVGIFDLAPVIILLPFISFLTALAIG----NRLPKGGALTGITATGGSLLIAI----ATA
21390|gene|hbo      MAGIFEFVPAIVLLPFVSFLVALFAG----KYMPKGGAFAGIVATAGSFLLSI----ATF
                                                                                

692|hp|hhi          ----------------------MNR------------PLA--------------------
2310|gene|nph       LT---GEPHNQTWYTLVA----GDE-IVELSFGILIDQLSASMLVIVSLIAFLVHVFSLG
694|gene|hut        VAVANGDPYHAELYTFLS----GEG-AISLHFGILIDPLSALMLTLVSLIALLVFVFSLG
712|gene|hla        ATVAGGEAANRTLYTWASAGGIGPT-DVELSFGILIDPLSALMLVIVTLVALLVHVFSLG
11455|gene|hma      LTVAGGEVHNEILYTWTA----SVE-SLRLNFGLLLDPLSALMLLIVCLISFLVHIFSLG
2036|gene|hhi       LTVAGGEVHNEILYQWTT----SVE-SLQLNFGLLLDPLSALMLLIVCLISFLVHIFSLG
646|gene|nrc1       VTVSQGEYIAESIYTWVA----APN-AFSLHFGVLVDPLAAMMLVIVSLVAFLVHVFSLG
1646|gene|hwa       VAVSGGRVYTATIYTWAS----GLD-VVNLTFGVLIDPLSAMMLVIVTLVSFLVHIFSLG
21390|gene|hbo      FTVSQGQTYNQTIYTWAN----GLDGAVTLEFGLLIDPLSAMMLVIVTLIAFLVHVFSLG
                                                          *:                    

692|hp|hhi          ------------------------------------------------------------
2310|gene|nph       YMNDEGEPGLPRYYAGLSLFTASMLAFVIADNLFMAFVFFELVGLCSYLLIGHWFREDAP
694|gene|hut        YMNDEGEGGLRRYYAELSLFAFSMLAFVFADNLLMAFMFFELVGLCSYLLIGFWFREPGP
712|gene|hla        YMNDEGETGLPRYYAGLGLFTASMLGFVVADNLLMAFMFFELVGLCSYLLIGFNFREPGP
11455|gene|hma      YMNDEGENGLPRYYAGLGLFTASMLGFVVANNLLMAFMFFELVGLCSYLLIGFWFRDDGP
2036|gene|hhi       YMNDEGETGLPRYYAGLGLFTASMLGFVVANNLLMAFMFFELVGLCSYLLIGFWFRDDGP
646|gene|nrc1       YMNDEGEGGLHRYYAGLGLFTFSMLAFVVADNLLMAFMFFELVGLCSYLLIGFHFRQQGP
1646|gene|hwa       YMNDEGEVGLPRYYAGLGLFSASMLGFVVADNLLMAFMFFELVGLCSYLLIGFWFREPGP
21390|gene|hbo      YMNDEGETGLPRYYAGLGLFSASMLGFVVADNLLMAFMFFELVGLCSYLLIGFWFREPGP
                                                                                

692|hp|hhi          ------------FAAVSFIATLVALLVLMQTALV----AGG-------------------
2310|gene|nph       PSAAKKAFLVTRFGDYFFLVGVVGVLVTFGTAQF----AGA----EGFPALAQAAL----
694|gene|hut        ASAAKKAFLVTRFGDYFFLVGTVAILSMFGTGLF----VGE----EGFPKLAQHAID---
712|gene|hla        PSAAKKAFLVTRFGDYFFLIGVVAVLATFGTAQF----AGE----GSFPALADAALN---
11455|gene|hma      PSAAKKAFLVTRFGDYFFLIGVVGIFATFGTGLFAPITQGGEVVAESFPMLAEHALVDGE
2036|gene|hhi       PSAAKKAFLVTRFGDYFFLIGVVGIFATFGTGLFAPITQGGEVVAESFPMLAEHAIVDGE
646|gene|nrc1       PSAAKKAFLVTRFGDYFFLIGVVAVFATFGTARFVATGEGA----HAFPHMAEQALAAVG
1646|gene|hwa       PSAAKKAFLVTRFGDYFFLIGVVAVFATFGTAAF----SGS----GSFPALAEAALL---
21390|gene|hbo      PSAAKKAFLVTRFGDYFFLIGVVAVFATFGTAAF----AGG----ESFPHLAEQAL----
                                *.   *:   *.::  : *. .     *                    

692|hp|hhi          ------------------------------------------------------------
2310|gene|nph       -DG------EAAIQTFGLSVEGWLSVLGLLVLGGVLGKSAQFPLHTWLPDAMEGPTPVSA
694|gene|hut        --G------GQT--FYGLGAETAITLAGLLVLGGVIGKSAQFPLHTWLPDAMEGPTPVSA
712|gene|hla        GSG------SVAWTPGGVELQTWLTVVGLLVLGGVVGKSAQFPLHTWLPDAMEGPTPVSA
11455|gene|hma      LEG------IAMLETVGMGPQAWFTVLGLLVLGGVVGKSAQFPLHTWLPDAMEGPTPVSA
2036|gene|hhi       TEG------IAMLETVGMGPQQWFTVLGLLVLGGVVGKSAQFPLHTWLPDAMEGPTPVSA
646|gene|nrc1       GEGTMPAHVAHFLDVVGMSAQQWFSVVGLLVLGGVIGKSAQFPLHTWLPDAMEGPTPVSA
1646|gene|hwa       GEA------AESVRTFGFEPQLWFTIIGLLILGGVVGKSAQFPLHTWLPDAMEGPTPVSA
21390|gene|hbo      -HG------EHAVNTFGFEPQTWFTIVGLLVLGGVVGKSAQFPLHTWLPDAMEGPTPVSA
                                                                                

692|hp|hhi          -------------------------PARALVLASLGGL----------------------
2310|gene|nph       LIHAATMVAAGVFLIARMYGFYALLPTVLAIIAFVGGFTALFAATMGVVKNEIKQVLAYS
694|gene|hut        LIHAATMVAAGVYLVARMYGFYLLSPTALGVIALVGGFTALFAASMALVKQELKQVLAYS
712|gene|hla        LIHAATMVAAGVYLVARMYGFYALSPTALAVIAFIGGFTALFAATMGLVKDELKQVLAYS
11455|gene|hma      LIHAATMVAAGVYLVARMYGFYALSPTALAVIALIGGFTALFAATMGLVKQEIKQVLAYS
2036|gene|hhi       LIHAATMVAAGVYLVARMYGFYALSPTALAVIALIGGFTALFAATMGLVKQEIKQVLAYS
646|gene|nrc1       LIHAATMVAAGVYLVARMYGFYALLPTVLAIIALVGGFTALFAATMGVVKDELKQVLAYS
1646|gene|hwa       LIHAATMVAAGVYLVARMYGFYALSPTALAVIAFFGGFTALVAATMGVVKREIKQVLAYS
21390|gene|hbo      LIHAATMVAAGVYLVARMYGFYALSPNALAIIALIGGFTALFAATMGVVKREIKQVLAYS
                                             *    ::* .**:                      

692|hp|hhi          --------------GTYVA-----------------------------------------
2310|gene|nph       TISQYGYMMVALGAGSYVAAFFHLTTHAIFKALLFLGAGAVIIAMHHNENMWDMGGLKDE
694|gene|hut        TISQYGYMMLALGGGGYVAAVFHLTTHAIFKALLFLGAGSVIIAMHHNENMWDMGGLKDK
712|gene|hla        TISQYGYMMLALGAGGYVAAVFHLTTHAFFKALLFLGAGAVIIAMHHNEDMWDMGGLKSK
11455|gene|hma      TISQYGYMMLALGSGGYIAAVFHLTTHAVFKALLFLGAGSVIIAMHHNENMWDMGGLKDR
2036|gene|hhi       TISQYGYMMLALGSGGYIAAVFHLTTHAVFKALLFLGAGSVIIAMHHNENMWDMGGLKDR
646|gene|nrc1       TISQYGYMMLGLGTGGYIAASFHLLTHAFFKALLFLGAGSVIIAMHHNENMWDMGGLRKK
1646|gene|hwa       TISQYGYIMLGLGGGGYVAATFHLMTHAFFKALLFLGAGSVIIAMHHTEDMWEMGGLKKK
21390|gene|hbo      TISQYGYMMLGLGGGGYIAATFHLMTHAFFKALLFLGAGSVIIAMHHNEDMWDMGGLKDR
                                  * *:*                                         

692|hp|hhi          ------------------------------------------------------------
2310|gene|nph       MRVTYLTFLAGSLALAGIFPFSGFWSKDEVLFDTLVHALGGS----TLLLGAYIMALGAV
694|gene|hut        MPVTYYAFLSGSLALAGIFPFAGFWSKDEVLYETLIHGLGGS----PLLLAGYAMGLAAV
712|gene|hla        MPVTYYTFLAGSLALAGIFPFAGFWSKDEILYEALVHGLND-----PLLLGGYLMGLLAV
11455|gene|hma      MPVTYWTFLAGSLALAGIVPFAGFWSKDEVLYEALIHGFGTEGGLGTAYLVAYAMGLLAV
2036|gene|hhi       MPVTYWTFLAGSLALAGIVPFAGFWSKDEVLYEALIHGFGTEGGLGTAYLVAYAMGLLAV
646|gene|nrc1       MPVTYYTFLSGSLALAGIVPFAGFWSKDEILYEALIYGAGDS----PILLAAYAMGLLAV
1646|gene|hwa       LPVTYYTFVTGSLALAGIIPFAGFWSKDEVLYETLLHGLDGN----TILLAAYAMGLIAV
21390|gene|hbo      MPVTYYTFLSGSLALAGIVPFAGFWSKDEVLYETLIHGLGGN----PILLAAYAMGLLAV
                                                                                

692|hp|hhi          ------------------------------------------------------------
2310|gene|nph       FLTGFYTIRMVMLTFHGEPRSDTAEDPHGVRWNVKTPLSVLGVLAVVAGVINLVPVEKLT
694|gene|hut        AFTGFYTFRMVLLTFHGEPRTETAENPHAVRWNVKLPLAVLGILAAVGGVINLAPVEKVT
712|gene|hla        PVTAFYTFRMVFLTFHGEPRSETARDPEPVRWNVKGPLTVLGTLAVVTGFINMVPVQKVL
11455|gene|hma      FFTGFYTFRMVYLTFHGDARSDTARDPEPVRWNVKGPLTVLGILATTIGFINMKPVAELT
2036|gene|hhi       FFTGFYTFRMVYLTFHGDARSDTARDPEPVRWNVKGPLTVLGILATTIGFINMAPVAKLT
646|gene|nrc1       FFTGFYTFRMVVLTFHGEPRSDTAEDPHGVRWNVKFPLVVLGVLAATVGLVNMTPVAEAT
1646|gene|hwa       FFTGFYTFRMVFLTFHGNPRSETAREPENVGMNIKIPLTILGILAATTGFLNMTPVAKLT
21390|gene|hbo      FFTGFYTFRMVFLTFHGKPRTQTARDPHGVRWNVKFPLVVLGILAATAGLVNMTPVAEFT
                                                                                

692|hp|hhi          ------------------------------------------------------------
2310|gene|nph       GLE-VSFLSEFLS------RDVGLLTDNAHYSELLETAAYAGYETGYLGGG-EEMTVLLG
694|gene|hut        GVH-LTFLHDWLG-------SATELLSVHHYEVLLHD--YAHYTAENPLG--EVGTVLAG
712|gene|hla        GLEGIDILHRWLD----NEWGGIEGLSSHHYADLGPY--SS----GSLVGG-EVGTVLVG
11455|gene|hma      GAH-IDFLHVWLNGPEEGGWPATLNTGLHHYETLLHD--VAHITKGYPLG--ETTTLLAS
2036|gene|hhi       GAH-IDFLHKWLTGPENGGWPAALNTGLHHYEGLLHD--VSHVVKGYPLG--ETPTLLAS
646|gene|nrc1       GLH-IEFLHTWLAGPEGTAFSA---LGYEHYHHLLES--FA----GYHAA--DIAPFVPA
1646|gene|hwa       GLH-IEFLHKWLE----HGFTG---LTVEHYGELLHD--VA----GYGATGIELSPILPG
21390|gene|hbo      GLH-IEFLHQWLN----HGVEG---LTNHHYHELLEN--VA----GYHAA--ELNPLAPG
                                                                                

692|hp|hhi          ------------------------------------------------------------
2310|gene|nph       AGLGLGLALLGAGSAYGLYRGSDPVRHTAKLGSLQTVLMHNYYQDEYQVWLAEGFTVRLS
694|gene|hut        AAVSLGLALLGAGIAYRLYAVPDPEEHTDRLGGLKTLLMNNYYQDEYQVWLARGVTVPIA
712|gene|hla        AAVSLGLALAGLTVAWRLYNVPSPTEHTAKLGGIKDVLYNNYYLDELQVWLAYR-TEDIA
11455|gene|hma      AGVSLGLALAGVLVARSLYAGADPVEHTDKLGGLKTLLMHNYYQDEYQVWLATGVTYPLA
2036|gene|hhi       AGVSLGLALAGVFVARSLYAGADPVEHTDKLGGLKTLLMHNYYQDEYQVWLATGVTYPLA
646|gene|nrc1       A-VSLALALGGAGLAWLLYSGPAPTKHTEKLGAARTLLYNNYYQDEYQVWLAKGVTLPLA
1646|gene|hwa       A-VSLGLALAGFLLAYQLYNVPEPVAHTDRLGSLKTMVYNNYYQDEYQVWIATGFTQPLA
21390|gene|hbo      A-VSLALALAGAGLAHMLYNVPEPKEHTAKLGGIKTLLYNNYYQDEYQVWLANSVVRPIS
                                                                                

692|hp|hhi          -------------------------------IKSGVLKS---------------------
2310|gene|nph       KAADTFDQGVIDGAVNATSSVSLAAGDRVRRLQTGLVTNYAALIILGLLALLVFFAVLGG
694|gene|hut        RAADTFDQSIVDGVVNATSSVSLFGSERVRRIQSGVVTNYASLVTLGLVALLVAFALLGG
712|gene|hla        GGANTFDQGIIDGVVNSVSSVSLFGGSRVRRLQSGVVSQYAMLLTLGLIALLLALGVTGG
11455|gene|hma      RVMNKFDQGVVDGVVNGISSVSLFGGSRIRRIQSGVVSNYATLLTLGLVLLLAAFGIMGG
2036|gene|hhi       RVMNKFDQGVVDGVVNGISSVSLFGGSRIRRIQSGVVSNYATLLTLGLVLLLAAFGIMGG
646|gene|nrc1       RGADTFDQGVIDGIVNAVSSISLFSGGRIRRIQDGIVSHYATMLTLGLVALLVVFGVTGG
1646|gene|hwa       RVASKLDQGVIDGVVNGVSGVSLFAGSRVRRIQTGIVSNYAALLTLGLTALLVGLGLMGG
21390|gene|hbo      RGADKFDQGVVDGVVNGISSVSLFSGSRIRRIQSGVVSNYAMLLTLGLTVLLLGFGLAGG
                                                   :: *::.                      

692|hp|hhi          ---
2310|gene|nph       WF-
694|gene|hut        WF-
712|gene|hla        WFL
11455|gene|hma      WF-
2036|gene|hhi       WF-
646|gene|nrc1       WF-
1646|gene|hwa       WFV
21390|gene|hbo      WFA