HOG Organism Gene ID Name Annotation
aHOG1861 hla HLAC2118 Hlac_2118 CMP/dCMP deaminase zinc-binding
aHOG1861 hmu HMUK2072 Hmuk_2072 CMP/dCMP deaminase zinc-binding
aHOG1861 hwa HQ3374 cumB cytosine/adenosine deaminases
aHOG1861 hma Hma_13250 codA cytosine deaminase
MUSCLE (3.6) multiple sequence alignment


2118|gene|hla       MTDSTADGPGDDRNDSDATGDSTPSDRKYVDRAIELAEEAVEMGNTPFGALLVLDGEIVA
3374|gene|hwa       MIDSKFD---------------TFDHEMHMQEALKLARESAARGDEPFGSVLVRDDTVVM
13250|gene|hma      MPMSEFD---------------EFDHETHIQRAFELARTAVDRGDRPFGSVLVRDNEVVM
                    *  *  *                 .   ::: *::**  :.  *: ***::** *. :* 

2118|gene|hla       EAHNETLTEDDLAAHPELALARWAGRELDVDERARCTMYASTEPCPMCATGIHYAGIGRV
3374|gene|hwa       RESNHEITESDIRRHPELHLAYRACQAYDSDERAEMVMYTTTEPCPMCAGGMVTAGFDST
13250|gene|hma      EASNRVLTESDVRRHPELQLAHRAMQEFDPDERAETVMYTSTEPCPMCAGGLRYAGLGRV
                       *  :**.*:  **** ** .* .  * ****  .**::******** *:  **:. .

2118|gene|hla       VFGVAGETLDGLTGDAVSIPCAEVIRRAGGDTTVEGPIAEAAAMELHESVYGES
3374|gene|hwa       VYSVGSDEIAEFTGNEPSVRSANIL---DGITEITGPLLNDEGRQVHEEYNW--
13250|gene|hma      VYSVGSDEMGEFSGHEESVRSGEIL---AGITDVAGPICHEEGLAIHEDFDW--
                    *:.*..: :  ::*   *: ..:::    * * : **:    .  :**.